eF-site ID 1ycb-AB
PDB Code 1ycb
Chain A, B

click to enlarge
Title DISTAL POCKET POLARITY IN LIGAND BINDING TO MYOGLOBIN: DEOXY AND CARBONMONOXY FORMS OF A THREONINE68 (E11) MUTANT INVESTIGATED BY X-RAY CRYSTALLOGRAPHY AND INFRARED SPECTROSCOPY
Classification OXYGEN STORAGE
Compound MYOGLOBIN
Source Sus scrofa (Pig) (MYG_PIG)
Sequence A:  GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETL
EKFDKFKHLKSEDEMKASEDLKKHGNTTLTALGGILKKKG
HHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP
GDFGADAQGAMSKALELFRNDMAAKYKELGFQG
B:  GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETL
EKFDKFKHLKSEDEMKASEDLKKHGNTTLTALGGILKKKG
HHEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHP
GDFGADAQGAMSKALELFRNDMAAKYKELGFQG
Description (1)  MYOGLOBIN (DEOXY, PH 7.1) MUTANT WITH VAL 68 REPLACED BY THREONINE (V68T)


Functional site

1) chain A
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

2) chain A
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

3) chain A
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

4) chain A
residue 68
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

5) chain A
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

6) chain A
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

7) chain A
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

8) chain A
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

9) chain A
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

10) chain A
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

11) chain A
residue 138
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM A 154
source : AC1

12) chain B
residue 42
type
ligand
sequence K
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

13) chain B
residue 43
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

14) chain B
residue 64
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

15) chain B
residue 68
type
ligand
sequence T
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

16) chain B
residue 71
type
ligand
sequence A
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

17) chain B
residue 89
type
ligand
sequence L
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

18) chain B
residue 92
type
ligand
sequence S
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

19) chain B
residue 93
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

20) chain B
residue 97
type
ligand
sequence H
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

21) chain B
residue 99
type
ligand
sequence I
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

22) chain B
residue 103
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

23) chain B
residue 138
type
ligand
sequence F
description BINDING SITE FOR RESIDUE HEM B 154
source : AC2

24) chain A
residue 64
type METAL
ligand
sequence H
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI1

25) chain A
residue 93
type METAL
ligand
sequence H
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI2

26) chain B
residue 64
type METAL
ligand
sequence H
description Iron (heme distal ligand)
source Swiss-Prot : SWS_FT_FI3

27) chain B
residue 93
type METAL
ligand
sequence H
description Iron (heme proximal ligand)
source Swiss-Prot : SWS_FT_FI4


Display surface

Download
Links