eF-site ID 1xyd_6-A PDB Code 1xyd Model 6 Chain A click to enlarge Title NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures Classification METAL BINDING PROTEIN Compound S-100 protein, beta chain Source null (S100B_RAT) Sequence A:  MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNE LSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSM VTTACHEFFEHE Description Functional site 1) chain A residue 17 type sequence Y description BINDING SITE FOR RESIDUE CA A 92 source : AC1 2) chain A residue 18 type sequence S description BINDING SITE FOR RESIDUE CA A 92 source : AC1 3) chain A residue 21 type sequence E description BINDING SITE FOR RESIDUE CA A 92 source : AC1 4) chain A residue 26 type sequence K description BINDING SITE FOR RESIDUE CA A 92 source : AC1 5) chain A residue 28 type sequence K description BINDING SITE FOR RESIDUE CA A 92 source : AC1 6) chain A residue 31 type sequence E description BINDING SITE FOR RESIDUE CA A 92 source : AC1 7) chain A residue 61 type sequence D description BINDING SITE FOR RESIDUE CA A 93 source : AC2 8) chain A residue 63 type sequence D description BINDING SITE FOR RESIDUE CA A 93 source : AC2 9) chain A residue 65 type sequence D description BINDING SITE FOR RESIDUE CA A 93 source : AC2 10) chain A residue 67 type sequence E description BINDING SITE FOR RESIDUE CA A 93 source : AC2 11) chain A residue 72 type sequence E description BINDING SITE FOR RESIDUE CA A 93 source : AC2 12) chain A residue 15 type sequence H description BINDING SITE FOR RESIDUE ZN A 94 source : AC3 13) chain A residue 24 type sequence K description BINDING SITE FOR RESIDUE ZN A 94 source : AC3 14) chain A residue 25 type sequence H description BINDING SITE FOR RESIDUE ZN A 94 source : AC3 15) chain A residue 85 type sequence H description BINDING SITE FOR RESIDUE ZN B 94 source : AC6 16) chain A residue 89 type sequence E description BINDING SITE FOR RESIDUE ZN B 94 source : AC6 17) chain A residue 2 type MOD_RES sequence E description N-acetylserine => ECO:0000250|UniProtKB:P02638 source Swiss-Prot : SWS_FT_FI4 18) chain A residue 66 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 19) chain A residue 68 type BINDING sequence C description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 20) chain A residue 73 type BINDING sequence F description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 21) chain A residue 62 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 22) chain A residue 64 type BINDING sequence G description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448, ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI3 23) chain A residue 61-73 type prosite sequence DEDGDGECDFQEF description EF_HAND_1 EF-hand calcium-binding domain. DEDGDGECDfqEF source prosite : PS00018 24) chain A residue 56-77 type prosite sequence VMETLDEDGDGECDFQEFMAFV description S100_CABP S-100/ICaBP type calcium binding protein signature. VMetLDedgDgecDFqEFmaFV source prosite : PS00303 25) chain A residue 16 type BINDING sequence Q description BINDING => ECO:0000305|PubMed:14621986 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 26 type BINDING sequence K description BINDING => ECO:0000305|PubMed:14621986 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 86 type BINDING sequence E description BINDING => ECO:0000305|PubMed:14621986 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 91 type BINDING sequence E description BINDING => ECO:0000305|PubMed:14621986 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 22 type BINDING sequence G description BINDING => ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI2 30) chain A residue 27 type BINDING sequence L description BINDING => ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI2 31) chain A residue 32 type BINDING sequence L description BINDING => ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI2 32) chain A residue 19 type BINDING sequence G description BINDING => ECO:0000269|PubMed:18949447, ECO:0007744|PDB:2K7O source Swiss-Prot : SWS_FT_FI2

Display surface Download Links