eF-site ID 1xtm-A PDB Code 1xtm Chain A click to enlarge Title Crystal structure of the double mutant Y88H-P104H of a SOD-like protein from Bacillus subtilis. Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION Compound Hypothetical superoxide dismutase-like protein yojM Source Bacillus subtilis (YOJM_BACSU) Sequence A:  AFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRP GASLGFHIHEKGSCVRPDFESAGGHFNPLNKEHGFNNPMG HHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDED GSAFIIHEQADDYLTNPSGNSGARIVCGALLG Description Functional site 1) chain A residue 71 type sequence H description BINDING SITE FOR RESIDUE ZN B 502 source : AC3 2) chain A residue 137 type sequence D description BINDING SITE FOR RESIDUE ZN B 502 source : AC3 3) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE CU A 503 source : AC4 4) chain A residue 88 type sequence H description BINDING SITE FOR RESIDUE CU A 503 source : AC4 5) chain A residue 104 type sequence H description BINDING SITE FOR RESIDUE CU A 503 source : AC4 6) chain A residue 166 type sequence H description BINDING SITE FOR RESIDUE CU A 503 source : AC4 7) chain A residue 104 type sequence H description BINDING SITE FOR RESIDUE ZN A 504 source : AC5 8) chain A residue 112 type sequence H description BINDING SITE FOR RESIDUE ZN A 504 source : AC5 9) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE ZN A 504 source : AC5 10) chain A residue 124 type sequence D description BINDING SITE FOR RESIDUE ZN A 504 source : AC5 11) chain A residue 71 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 12) chain A residue 137 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 13) chain A residue 86 type BINDING sequence H description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 14) chain A residue 166 type BINDING sequence H description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links