eF-site ID 1xtl-A PDB Code 1xtl Chain A click to enlarge Title Crystal structure of P104H mutant of SOD-like protein from Bacillus subtilis. Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION Compound Hypothetical superoxide dismutase-like protein yojM Source Bacillus subtilis (YOJM_BACSU) Sequence A:  AFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRP GASLGFHIYEKGSCVRPDFESAGGHFNPLNKEHGFNNPMG HHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDED GSAFIIHEQADDYLTNPSGNSGARIVCGALLG Description Functional site 1) chain A residue 86 type sequence H description BINDING SITE FOR RESIDUE CU A 1173 source : AC3 2) chain A residue 88 type sequence Y description BINDING SITE FOR RESIDUE CU A 1173 source : AC3 3) chain A residue 104 type sequence H description BINDING SITE FOR RESIDUE CU A 1173 source : AC3 4) chain A residue 166 type sequence H description BINDING SITE FOR RESIDUE CU A 1173 source : AC3 5) chain A residue 104 type sequence H description BINDING SITE FOR RESIDUE ZN A 1174 source : AC4 6) chain A residue 112 type sequence H description BINDING SITE FOR RESIDUE ZN A 1174 source : AC4 7) chain A residue 121 type sequence H description BINDING SITE FOR RESIDUE ZN A 1174 source : AC4 8) chain A residue 124 type sequence D description BINDING SITE FOR RESIDUE ZN A 1174 source : AC4 9) chain A residue 71 type sequence H description BINDING SITE FOR RESIDUE ZN A 1327 source : BC1 10) chain A residue 137 type sequence D description BINDING SITE FOR RESIDUE ZN A 1327 source : BC1 11) chain A residue 89 type sequence E description BINDING SITE FOR RESIDUE ZN A 1331 source : BC5 12) chain A residue 157 type sequence D description BINDING SITE FOR RESIDUE ZN A 1331 source : BC5 13) chain A residue 159 type sequence D description BINDING SITE FOR RESIDUE ZN A 1331 source : BC5 14) chain A residue 160 type sequence G description BINDING SITE FOR RESIDUE ZN A 1331 source : BC5 15) chain A residue 71 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 137 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI1 17) chain A residue 86 type BINDING sequence H description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 18) chain A residue 166 type BINDING sequence H description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links