eF-site ID 1xsw_4-A PDB Code 1xsw Model 4 Chain A click to enlarge Title The solid-state NMR structure of Kaliotoxin Classification TOXIN Compound Kaliotoxin 1 Source null (SCK1_ANDMA) Sequence A:  GVEINVKCSGSPQCLKPCKDAGMRFGKCMNRKCHCTPK Description Functional site 1) chain A residue 14-35 type prosite sequence CLKPCKDAGMRFGKCMNRKCHC description SCORP_SHORT_TOXIN Scorpion short toxins signature. ClkpCkdagmrf..GKCMnrkChC source prosite : PS01138

Display surface Download Links