eF-site ID 1xqm-A PDB Code 1xqm Chain A click to enlarge Title Variations on the GFP chromophore scaffold: A fragmented 5-membered heterocycle revealed in the 2.1A crystal structure of a non-fluorescent chromoprotein Classification LUMINESCENT PROTEIN Compound kindling fluorescent protein Source (AAO43187) Sequence A:  SLLTETMPFKTTIEGTVNGHCFKCIGKGEGNPFEGTQEMK IEVIEGGPLPFAFHILSTSCXSKTFIKYVSGIPDYFKQSF PEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGN NFPADGPVMQNKVGRWEPGTEIVYEVDGVLRGQSLMALKC PGGRHLTCHLHTTYRSKKPASALKMPGFHFEDHRIEIMEE VEKGKCYKQYEAAVGRYCDAAPSKLGHN Description (1)  kindling fluorescent protein Functional site 1) chain A residue 139 type sequence R description BINDING SITE FOR RESIDUE ACY A 1001 source : AC1 2) chain A residue 200 type sequence E description BINDING SITE FOR RESIDUE ACY A 1001 source : AC1 3) chain A residue 201 type sequence I description BINDING SITE FOR RESIDUE ACY A 1001 source : AC1 4) chain A residue 203 type sequence E description BINDING SITE FOR RESIDUE ACY A 1001 source : AC1 5) chain A residue 229 type sequence L description BINDING SITE FOR RESIDUE ACY A 1001 source : AC1 6) chain A residue 231 type sequence H description BINDING SITE FOR RESIDUE ACY A 1001 source : AC1 7) chain A residue 62 type SITE sequence C description Cleavage => ECO:0000269|PubMed:15542608 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 66 type MOD_RES sequence S description (E)-2,3-didehydrotyrosine => ECO:0000269|PubMed:15542608 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 63 type CROSSLNK sequence X description 2-iminomethyl-5-imidazolinone (Met-Gly) => ECO:0000269|PubMed:15542608 source Swiss-Prot : SWS_FT_FI3 10) chain A residue 67 type CROSSLNK sequence K description 2-iminomethyl-5-imidazolinone (Met-Gly) => ECO:0000269|PubMed:15542608 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links