eF-site ID 1xd7-A PDB Code 1xd7 Chain A click to enlarge Title Crystal structure of a putative DNA binding protein Classification DNA BINDING PROTEIN Compound ywnA Source (P71036_BACSU) Sequence A:  SRLAVAIHILSLISMDEKTSSEIIADSVNTNPVVVRRMIS LLKKADILTSRAGVPGASLKKDPADISLLEVYRAVQKNPK CPVGKKIQNALDETFESVQRAMENELASKSLKDVMN Description Functional site 1) chain A residue 25 type sequence S description BINDING SITE FOR RESIDUE SO4 A 190 source : AC1 2) chain A residue 26 type sequence S description BINDING SITE FOR RESIDUE SO4 A 190 source : AC1 3) chain A residue 41 type sequence R description BINDING SITE FOR RESIDUE SO4 A 190 source : AC1 4) chain A residue 60 type sequence P description BINDING SITE FOR RESIDUE SO4 A 190 source : AC1 5) chain A residue 61 type sequence G description BINDING SITE FOR RESIDUE SO4 A 190 source : AC1 6) chain A residue 116 type sequence R description BINDING SITE FOR RESIDUE SO4 A 190 source : AC1 7) chain A residue 120 type sequence N description BINDING SITE FOR RESIDUE SO4 A 190 source : AC1 8) chain A residue 26-49 type DNA_BIND sequence SEIIADSVNTNPVVVRRMISLLKK description H-T-H motif => ECO:0000255|PROSITE-ProRule:PRU00540 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links