eF-site ID 1xcc-D
PDB Code 1xcc
Chain D

click to enlarge
Title 1-Cys peroxidoxin from Plasmodium Yoelli
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound 1-Cys peroxiredoxin
Source Plasmodium yoelii (Q86SB3_9APIC)
Sequence D:  LGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFT
PVCTTELAELGKMHEDFLKLNCKLIGFSCNSKESHDKWIE
DIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKDITGL
PLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSL
QLTYTTPVATPVNWNEGDKCCVIPTLQDDEISKHFKNEIT
KVEMPSKKKYLRFVNL
Description (1)  1-Cys peroxiredoxin


Functional site

1) chain D
residue 47
type ACT_SITE
ligand
sequence C
description Cysteine sulfenic acid (-SOH) intermediate. {ECO:0000256|PIRSR: PIRSR000239-1}.
source Swiss-Prot : SWS_FT_FI4


Display surface

Download
Links