eF-site ID 1x9i-AB PDB Code 1x9i Chain A, B click to enlarge Title Crystal structure of Crystal structure of phosphoglucose/phosphomannose phosphoglucose/phosphomannoseisomerase from Pyrobaculum aerophilum in complex with glucose 6-phosphate Classification ISOMERASE Compound glucose-6-phosphate isomerase Source (NP_559417) Sequence A:  SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLY ISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDG LLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQM GVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPE GLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEF NENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEH QERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLA EIRGVNPLATPRIDALKRRL B:  SQLLQDYLNWENYILRRVDFPTSYVVEGEVVRIEAMPRLY ISGMGGSGVVADLIRDFSLTWNWEVEVIAVKDYFLKARDG LLIAVSYSGNTIETLYTVEYAKRRRIPAVAITTGGRLAQM GVPTVIVPKASAPRAALPQLLTAALHVVAKVYGIDVKIPE GLEPPNEALIHKLVEEFQKRPTIIAAESMRGVAYRVKNEF NENAKIEPSVEILPEAHHNWIEGSERAVVALTSPHIPKEH QERVKATVEIVGGSIYAVEMHPKGVLSFLRDVGIASVKLA EIRGVNPLATPRIDALKRRLQ Description Functional site 1) chain A residue 45 type sequence M description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 2) chain A residue 46 type sequence G description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 3) chain A residue 47 type sequence G description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 4) chain A residue 48 type sequence S description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 5) chain A residue 87 type sequence S description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 6) chain A residue 88 type sequence Y description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 7) chain A residue 89 type sequence S description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 8) chain A residue 92 type sequence T description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 9) chain A residue 134 type sequence P description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 10) chain A residue 135 type sequence R description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 11) chain A residue 203 type sequence E description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 12) chain A residue 298 type sequence K description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 13) chain B residue 219 type sequence H description BINDING SITE FOR RESIDUE G6Q A 600 source : AC1 14) chain A residue 219 type sequence H description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 15) chain B residue 45 type sequence M description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 16) chain B residue 46 type sequence G description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 17) chain B residue 47 type sequence G description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 18) chain B residue 48 type sequence S description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 19) chain B residue 87 type sequence S description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 20) chain B residue 88 type sequence Y description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 21) chain B residue 89 type sequence S description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 22) chain B residue 92 type sequence T description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 23) chain B residue 134 type sequence P description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 24) chain B residue 135 type sequence R description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 25) chain B residue 203 type sequence E description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 26) chain B residue 298 type sequence K description BINDING SITE FOR RESIDUE G6Q B 601 source : AC2 27) chain A residue 53 type sequence D description BINDING SITE FOR RESIDUE GOL A 701 source : AC3 28) chain A residue 72 type sequence K description BINDING SITE FOR RESIDUE GOL A 701 source : AC3 29) chain A residue 191 type sequence R description BINDING SITE FOR RESIDUE GOL A 701 source : AC3 30) chain A residue 195 type sequence Y description BINDING SITE FOR RESIDUE GOL A 701 source : AC3 31) chain A residue 70 type sequence A description BINDING SITE FOR RESIDUE GOL A 702 source : AC4 32) chain A residue 71 type sequence V description BINDING SITE FOR RESIDUE GOL A 702 source : AC4 33) chain A residue 72 type sequence K description BINDING SITE FOR RESIDUE GOL A 702 source : AC4 34) chain A residue 73 type sequence D description BINDING SITE FOR RESIDUE GOL A 702 source : AC4 35) chain B residue 56 type sequence R description BINDING SITE FOR RESIDUE GOL A 702 source : AC4 36) chain B residue 188 type sequence E description BINDING SITE FOR RESIDUE GOL A 702 source : AC4 37) chain A residue 135 type catalytic sequence R description 736 source MCSA : MCSA1 38) chain A residue 203 type catalytic sequence E description 736 source MCSA : MCSA1 39) chain A residue 219 type catalytic sequence H description 736 source MCSA : MCSA1 40) chain A residue 298 type catalytic sequence K description 736 source MCSA : MCSA1 41) chain B residue 135 type catalytic sequence R description 736 source MCSA : MCSA2 42) chain B residue 203 type catalytic sequence E description 736 source MCSA : MCSA2 43) chain B residue 219 type catalytic sequence H description 736 source MCSA : MCSA2 44) chain B residue 298 type catalytic sequence K description 736 source MCSA : MCSA2 45) chain A residue 48 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI3 46) chain A residue 87 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI3 47) chain A residue 92 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI3 48) chain B residue 48 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI3 49) chain B residue 87 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI3 50) chain B residue 92 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI3 51) chain A residue 203 type ACT_SITE sequence E description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 52) chain A residue 298 type ACT_SITE sequence K description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 53) chain B residue 203 type ACT_SITE sequence E description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 54) chain B residue 298 type ACT_SITE sequence K description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 55) chain A residue 219 type ACT_SITE sequence H description Proton donor => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 56) chain B residue 219 type ACT_SITE sequence H description Proton donor => ECO:0000305 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links