eF-site ID 1wnt-A PDB Code 1wnt Chain A click to enlarge Title Structure of the tetrameric form of Human L-Xylulose Reductase Classification OXIDOREDUCTASE Compound L-xylulose reductase Source (DCXR_HUMAN) Sequence A:  MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRT QADLDSLVRECPGIEPVCVDLGDWEATERALGSVGPVDLL VNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVAR GLIARGVPGAIVNVSSQCSQRAVTNHSVYCSTKGALDMLT KVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM LNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEGG FWAC Description Functional site 1) chain A residue 14 type sequence G description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 2) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 3) chain A residue 17 type sequence K description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 4) chain A residue 18 type sequence G description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 5) chain A residue 19 type sequence I description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 6) chain A residue 38 type sequence S description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 7) chain A residue 39 type sequence R description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 8) chain A residue 40 type sequence T description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 9) chain A residue 59 type sequence V description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 10) chain A residue 60 type sequence D description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 11) chain A residue 61 type sequence L description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 12) chain A residue 62 type sequence G description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 13) chain A residue 83 type sequence N description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 14) chain A residue 85 type sequence A description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 15) chain A residue 102 type sequence R description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 16) chain A residue 106 type sequence V description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 17) chain A residue 134 type sequence V description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 18) chain A residue 135 type sequence S description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 19) chain A residue 149 type sequence Y description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 20) chain A residue 153 type sequence K description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 21) chain A residue 179 type sequence P description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 22) chain A residue 180 type sequence T description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 23) chain A residue 181 type sequence V description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 24) chain A residue 182 type sequence V description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 25) chain A residue 184 type sequence T description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 26) chain A residue 185 type sequence S description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 27) chain A residue 186 type sequence M description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 28) chain A residue 187 type sequence G description BINDING SITE FOR RESIDUE NAP A 245 source : AC1 29) chain A residue 21 type MOD_RES sequence R description Omega-N-methylarginine => ECO:0007744|PubMed:24129315 source Swiss-Prot : SWS_FT_FI4 30) chain A residue 46 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:24275569 source Swiss-Prot : SWS_FT_FI5 31) chain A residue 136-164 type prosite sequence SQCSQRAVTNHSVYCSTKGALDMLTKVMA description ADH_SHORT Short-chain dehydrogenases/reductases family signature. SqcsqravtnHsvYCSTKGALdMLTkVMA source prosite : PS00061 32) chain A residue 149 type ACT_SITE sequence Y description Proton acceptor source Swiss-Prot : SWS_FT_FI1 33) chain A residue 11 type BINDING sequence L description BINDING => ECO:0000269|PubMed:15103634 source Swiss-Prot : SWS_FT_FI2 34) chain A residue 136 type BINDING sequence S description BINDING => ECO:0000269|PubMed:15103634 source Swiss-Prot : SWS_FT_FI2 35) chain A residue 153 type BINDING sequence K description BINDING => ECO:0000269|PubMed:15103634 source Swiss-Prot : SWS_FT_FI2 36) chain A residue 1 type MOD_RES sequence M description N-acetylmethionine => ECO:0000269|PubMed:12665801, ECO:0007744|PubMed:22223895, ECO:0007744|PubMed:22814378, ECO:0007744|PubMed:25944712 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links