eF-site ID 1wge_8-A PDB Code 1wge Model 8 Chain A click to enlarge Title Solution structure of the mouse DESR1 Classification METAL BINDING PROTEIN Compound Hypothetical protein 2610018L09Rik Source Mus musculus (Mouse) (ZCSL2_MOUSE) Sequence A:  GSSGSSGMAVFHDEVEIEDFQYDEDSETYFYPCPCGDNFA ITKEDLENGEDVATCPSCSLIIKVIYDKDQFMCGETVSGP SSG Description Functional site 1) chain A residue 33 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 2) chain A residue 35 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 3) chain A residue 55 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 4) chain A residue 58 type sequence C description BINDING SITE FOR RESIDUE ZN A 201 source : AC1 5) chain A residue 33 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:Q96FX2 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 35 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:Q96FX2 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 55 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:Q96FX2 source Swiss-Prot : SWS_FT_FI1 8) chain A residue 58 type BINDING sequence C description BINDING => ECO:0000250|UniProtKB:Q96FX2 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links