eF-site ID 1vps-B
PDB Code 1vps
Chain B

click to enlarge
Title POLYOMAVIRUS VP1 PENTAMER COMPLEXED WITH A DISIALYLATED HEXASACCHARIDE
Classification VIRAL PROTEIN
Compound POLYOMAVIRUS VP1 PENTAMER
Source Murine polyomavirus (strain P16 small-plaque) (MPyV) (COA1_POVMP)
Sequence B:  GGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQ
YYGWSRGINLATSDTEDSPGNNTLPTWSMAKLQLPMLNED
LTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTK
GISTPVEGSQYHVFAVGGEPLDLQGLVTDARTKYKEEGVV
TIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDP
AKNENTRYFGNYTGGTTTPPVLQFTNTLTTVLLDENGVGP
LCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLR
KRWVKNPYP
Description (1)  POLYOMAVIRUS VP1 PENTAMER


Functional site

1) chain B
residue 85
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SIA A 1
source : AC1

2) chain B
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA B 1
source : AC5

3) chain B
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA B 1
source : AC5

4) chain B
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SIA B 1
source : AC5

5) chain B
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA B 1
source : AC5

6) chain B
residue 293
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA B 1
source : AC5

7) chain B
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA B 1
source : AC5

8) chain B
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL B 2
source : AC6

9) chain B
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL B 2
source : AC6

10) chain B
residue 94
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GAL B 2
source : AC6

11) chain B
residue 80
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA B 4
source : AC8

12) chain B
residue 81
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SIA B 4
source : AC8

13) chain B
residue 83
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA B 4
source : AC8

14) chain B
residue 89
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA B 4
source : AC8

15) chain B
residue 186
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SIA B 4
source : AC8

16) chain B
residue 149
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA D 4
source : BC7

17) chain B
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_1

18) chain B
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_1

19) chain B
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_1

20) chain B
residue 289
type binding
ligand SIA: O-SIALIC ACID
sequence R
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_1

21) chain B
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_1

22) chain B
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_1

23) chain B
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_1

24) chain B
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_1

25) chain B
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1vps_B_2

26) chain B
residue 91
type binding
ligand GAL: BETA-D-GALACTOSE
sequence G
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1vps_B_2

27) chain B
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1vps_B_2

28) chain B
residue 80-83
type binding
ligand SIA: O-SIALIC ACID
sequence NLAT
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_4

29) chain B
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_4

30) chain B
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_4

31) chain B
residue 186
type binding
ligand SIA: O-SIALIC ACID
sequence K
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_B_4


Display surface

Download
Links