eF-site ID 1vps-A
PDB Code 1vps
Chain A

click to enlarge
Title POLYOMAVIRUS VP1 PENTAMER COMPLEXED WITH A DISIALYLATED HEXASACCHARIDE
Classification VIRAL PROTEIN
Compound POLYOMAVIRUS VP1 PENTAMER
Source Murine polyomavirus (strain P16 small-plaque) (MPyV) (COA1_POVMP)
Sequence A:  GGMEVLDLVTGPDSVTEIEAFLNPRMGQPPTPESLTEGGQ
YYGWSRGINLATSDTEDSPGNNTLPTWSMAKLQLPMLNED
LTCDTLQMWEAVSVKTEVVGSGSLLDVHGFNKPTDTVNTK
GISTPVEGSQYHVFAVGGEPLDLQGLVTDARTKYKEEGVV
TIKTITKKDMVNKDQVLNPISKAKLDKDGMYPVEIWHPDP
AKNENTRYFGNYTGGTTTPPVLQFTNTLTTVLLDENGVGP
LCKGEGLYLSCVDIMGWRVTRNYDVHHWRGLPRYFKITLR
KRWVK
Description (1)  POLYOMAVIRUS VP1 PENTAMER


Functional site

1) chain A
residue 72
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE SIA A 1
source : AC1

2) chain A
residue 77
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SIA A 1
source : AC1

3) chain A
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE SIA A 1
source : AC1

4) chain A
residue 291
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA A 1
source : AC1

5) chain A
residue 293
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA A 1
source : AC1

6) chain A
residue 298
type
ligand
sequence H
description BINDING SITE FOR RESIDUE SIA A 1
source : AC1

7) chain A
residue 78
type
ligand
sequence G
description BINDING SITE FOR RESIDUE GAL A 2
source : AC2

8) chain A
residue 93
type
ligand
sequence N
description BINDING SITE FOR RESIDUE GAL A 2
source : AC2

9) chain A
residue 94
type
ligand
sequence T
description BINDING SITE FOR RESIDUE GAL A 2
source : AC2

10) chain A
residue 80
type
ligand
sequence N
description BINDING SITE FOR RESIDUE SIA A 4
source : AC4

11) chain A
residue 81
type
ligand
sequence L
description BINDING SITE FOR RESIDUE SIA A 4
source : AC4

12) chain A
residue 83
type
ligand
sequence T
description BINDING SITE FOR RESIDUE SIA A 4
source : AC4

13) chain A
residue 89
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SIA A 4
source : AC4

14) chain A
residue 186
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SIA A 4
source : AC4

15) chain A
residue 85
type
ligand
sequence D
description BINDING SITE FOR RESIDUE SIA E 1
source : BC8

16) chain A
residue 72
type binding
ligand SIA: O-SIALIC ACID
sequence Y
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_1

17) chain A
residue 77-78
type binding
ligand SIA: O-SIALIC ACID
sequence RG
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_1

18) chain A
residue 289
type binding
ligand SIA: O-SIALIC ACID
sequence R
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_1

19) chain A
residue 291
type binding
ligand SIA: O-SIALIC ACID
sequence T
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_1

20) chain A
residue 293
type binding
ligand SIA: O-SIALIC ACID
sequence N
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_1

21) chain A
residue 296
type binding
ligand SIA: O-SIALIC ACID
sequence V
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_1

22) chain A
residue 298
type binding
ligand SIA: O-SIALIC ACID
sequence H
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_1

23) chain A
residue 77-80
type binding
ligand GAL: BETA-D-GALACTOSE
sequence RGIN
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1vps_A_2

24) chain A
residue 91
type binding
ligand GAL: BETA-D-GALACTOSE
sequence G
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1vps_A_2

25) chain A
residue 93-94
type binding
ligand GAL: BETA-D-GALACTOSE
sequence NT
description BETA-D-GALACTOSE binding site
source pdb_hetatom : GAL_1vps_A_2

26) chain A
residue 80-83
type binding
ligand SIA: O-SIALIC ACID
sequence NLAT
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_4

27) chain A
residue 87
type binding
ligand SIA: O-SIALIC ACID
sequence E
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_4

28) chain A
residue 89
type binding
ligand SIA: O-SIALIC ACID
sequence S
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_4

29) chain A
residue 186
type binding
ligand SIA: O-SIALIC ACID
sequence K
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_A_4

30) chain A
residue 85
type binding
ligand SIA: O-SIALIC ACID
sequence D
description O-SIALIC ACID binding site
source pdb_hetatom : SIA_1vps_E_1


Display surface

Download
Links