eF-site ID 1vee_8-A
PDB Code 1vee
Model 8
Chain A

click to enlarge
Title NMR structure of the hypothetical rhodanese domain At4g01050 from Arabidopsis thaliana
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound proline-rich protein family
Source Arabidopsis thaliana (Mouse-ear cress) (Y4105_ARATH)
Sequence A:  GSSGSSGSAKNAYTKLGTDDNAQLLDIRATADFRQVGSPN
IKGLGKKAVSTVYNGEDKPGFLKKLSLKFKDPENTTLYIL
DKFDGNSELVAELVALNGFKSAYAIKDGAEGPRGWLNSSL
PWIEPKKTSGPSSG
Description (1)  proline-rich protein family

Display surface

Download
Links