eF-site ID 1ve6-AB
PDB Code 1ve6
Chain A, B

click to enlarge
Title Crystal structure of an acylpeptide hydrolase/esterase from Aeropyrum pernix K1
Classification HYDROLASE
Compound Acylamino-acid-releasing enzyme
Source Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) (APEH_AERPE)
Sequence A:  EFSRIVRDVERLIAVEKYSLQGVVDGDKLLVVGFSEGSVN
AYLYDGGETVKLNREPINSVLDPHYGVGRVILVRDVSKGA
EQHALFKVNTSRPGEEQRLEAVKPMRILSGVDTGEAVVFT
GATEDRVALYALDGGGLRELARLPGFGFVSDIRGDLIAGL
GFFGGGRVSLFTSNLSSGGLRVFDSGEGSFSSASISPGMK
VTAGLETAREARLVTVDPRDGSVEDLELPSKDFSSYRPTA
ITWLGYLPDGRLAVVARREGRSAVFIDGERVEAPQGNHGR
VVLWRGKLVTSHTSLSTPPRIVSLPSGEPLLEGGLPEDLR
RSIAGSRLVWVESFDGSRVPTYVLESGRAPTPGPTVVLVH
GGPFAEDSDSWDTFAASLAAAGFHVVMPNYRGSTGYGEEW
RLKIIGDPCGGELEDVSAAARWARESGLASELYIMGYSYG
GYMTLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRN
FIEQLTGGSREIMRSRSPINHVDRIKEPLALIHPQNDSRT
PLKPLLRLMGELLARGKTFEAHIIPDAGHAINTMEDAVKI
LLPAVFFLATQRER
B:  EFSRIVRDVERLIAVEKYSLQGVVDGDKLLVVGFSEGSVN
AYLYDGGETVKLNREPINSVLDPHYGVGRVILVRDVSKGA
EQHALFKVNTSRPGEEQRLEAVKPMRILSGVDTGEAVVFT
GATEDRVALYALDGGGLRELARLPGFGFVSDIRGDLIAGL
GFFGGGRVSLFTSNLSSGGLRVFDSGEGSFSSASISPGMK
VTAGLETAREARLVTVDPRDGSVEDLELPSKDFSSYRPTA
ITWLGYLPDGRLAVVARREGRSAVFIDGERVEAPQGNHGR
VVLWRGKLVTSHTSLSTPPRIVSLPSGEPLLEGGLPEDLR
RSIAGSRLVWVESFDGSRVPTYVLESGRAPTPGPTVVLVH
GGPFAEDSDSWDTFAASLAAAGFHVVMPNYRGSTGYGEEW
RLKIIGDPCGGELEDVSAAARWARESGLASELYIMGYSYG
GYMTLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRN
FIEQLTGGSREIMRSRSPINHVDRIKEPLALIHPQNDSRT
PLKPLLRLMGELLARGKTFEAHIIPDAGHAINTMEDAVKI
LLPAVFFLATQRER
Description (1)  Acylamino-acid-releasing enzyme (E.C.3.4.19.1)


Functional site

1) chain A
residue 445
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI1

2) chain A
residue 524
type ACT_SITE
ligand
sequence D
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI1

3) chain A
residue 556
type ACT_SITE
ligand
sequence H
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI1

4) chain B
residue 445
type ACT_SITE
ligand
sequence S
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI2

5) chain B
residue 524
type ACT_SITE
ligand
sequence D
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI2

6) chain B
residue 556
type ACT_SITE
ligand
sequence H
description Charge relay system (By similarity).
source Swiss-Prot : SWS_FT_FI2

7) chain A
residue 445
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1c4x
source CSA : CSA1

8) chain A
residue 556
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1c4x
source CSA : CSA1

9) chain A
residue 524
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1c4x
source CSA : CSA1

10) chain B
residue 445
type catalytic
ligand
sequence S
description Annotated By Reference To The Literature 1c4x
source CSA : CSA2

11) chain B
residue 556
type catalytic
ligand
sequence H
description Annotated By Reference To The Literature 1c4x
source CSA : CSA2

12) chain B
residue 524
type catalytic
ligand
sequence D
description Annotated By Reference To The Literature 1c4x
source CSA : CSA2


Display surface

Download
Links