eF-site ID 1vdy_15-A
PDB Code 1vdy
Model 15
Chain A

click to enlarge
Title NMR Structure of the hypothetical ENTH-VHS domain At3g16270 from Arabidopsis thaliana
Classification structural genomics, unknown function
Compound hypothetical protein (RAFL09-17-B18)
Source Arabidopsis thaliana (Mouse-ear cress) (Q9C5H4_ARATH)
Sequence A:  GSSGSSGESYWRSRMIDAVTSDEDKVAPVYKLEEICDLLR
SSHVSIVKEFSEFILKRLDNKSPIVKQKALRLIKYAVGKS
GSEFRREMQRNSVAVRNLFHYKGHPDPLKGDALNKAVRET
AHETISAIFSEENGSGPSSG
Description (1)  hypothetical protein (RAFL09-17-B18)

Display surface

Download
Links