eF-site ID 1vd4_3-A PDB Code 1vd4 Model 3 Chain A click to enlarge Title Solution structure of the zinc finger domain of TFIIE alpha Classification TRANSCRIPTION Compound Transcription initiation factor IIE, alpha subunit Source null (T2EA_HUMAN) Sequence A:  RIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTF RCTFCHTEVEEDESAMPKKDAR Description Functional site 1) chain A residue 129 type sequence C description BINDING SITE FOR RESIDUE ZN A 175 source : AC1 2) chain A residue 132 type sequence C description BINDING SITE FOR RESIDUE ZN A 175 source : AC1 3) chain A residue 154 type sequence C description BINDING SITE FOR RESIDUE ZN A 175 source : AC1 4) chain A residue 157 type sequence C description BINDING SITE FOR RESIDUE ZN A 175 source : AC1 5) chain A residue 159 type sequence T description BINDING SITE FOR RESIDUE ZN A 175 source : AC1 6) chain A residue 129 type BINDING sequence C description BINDING => ECO:0000269|PubMed:27193682, ECO:0007744|PDB:5IY6 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 132 type BINDING sequence C description BINDING => ECO:0000269|PubMed:27193682, ECO:0007744|PDB:5IY6 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 154 type BINDING sequence C description BINDING => ECO:0000269|PubMed:27193682, ECO:0007744|PDB:5IY6 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 157 type BINDING sequence C description BINDING => ECO:0000269|PubMed:27193682, ECO:0007744|PDB:5IY6 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 129-157 type ZN_FING sequence CPVCSSTFTDLEANQLFDPMTGTFRCTFC description C4-type => ECO:0000255 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links