eF-site ID 1v8x-A PDB Code 1v8x Chain A click to enlarge Title Crystal Structure of the Dioxygen-bound Heme Oxygenase from Corynebacterium diphtheriae Classification OXIDOREDUCTASE Compound Heme oxygenase Source null (HMUO_CORDI) Sequence A:  TAGLAVELKQSTAQAHEKAEHSTFMSDLLKGRLGVAEFTR LQEQAWLFYTALEQAVDAVRASGFAESLLDPALNRAEVLA RDLDKLNGSSEWRSRITASPAVIDYVNRLEEIRDNVDGPA LVAHHYVRYLGDLSGGQVIARMMQRHYGVDPEALGFYHFE GIAKLKVYKDEYREKLNNLELSDEQREHLLKEATDAFVFN HQVFADLGKG Description Functional site 1) chain A residue 20 type BINDING sequence H description axial binding residue => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 25 type catalytic sequence H description 795 source MCSA : MCSA1 3) chain A residue 53 type catalytic sequence Y description 795 source MCSA : MCSA1 4) chain A residue 131 type catalytic sequence V description 795 source MCSA : MCSA1 5) chain A residue 132 type catalytic sequence R description 795 source MCSA : MCSA1 6) chain A residue 135 type catalytic sequence G description 795 source MCSA : MCSA1 7) chain A residue 136 type catalytic sequence D description 795 source MCSA : MCSA1 8) chain A residue 140 type catalytic sequence G description 795 source MCSA : MCSA1 9) chain A residue 125-135 type prosite sequence LVAHHYVRYLG description HEME_OXYGENASE Heme oxygenase signature. LVAHHYVRYLG source prosite : PS00593

Display surface Download Links