eF-site ID 1v3u-B
PDB Code 1v3u
Chain B

click to enlarge
Title Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase in apo form
Classification OXIDOREDUCTASE
Compound leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase
Source Cavia porcellus (Guinea pig) (Q9EQZ5_CAVPO)
Sequence B:  PEFMVKAKSWTLKKHFQGKPTQSDFELKTVELPPLKNGEV
LLEALFLSVDPYMRIASKRLKEGAVMMGQQVARVVESKNS
AFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKLPLSL
ALGTIGMPGLTAYFGLLEVCGVKGGETVLVSAAAGAVGSV
VGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVN
SLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIA
ICGAISVYNRMDQLPPGPSPESIIYKQLRIEGFIVYRWQG
DVREKALRDLMKWVLEGKIQYHEHVTKGFENMPAAFIEML
NGANLGKAVVTA
Description (1)  leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase (E.C.1.3.1.48)


Functional site

1) chain B
residue 149
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL B 1002
source : AC2

2) chain B
residue 151
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL B 1002
source : AC2

3) chain B
residue 173
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL B 1002
source : AC2

4) chain B
residue 174
type
ligand
sequence G
description BINDING SITE FOR RESIDUE CL B 1002
source : AC2

5) chain B
residue 178
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL B 1002
source : AC2

6) chain B
residue 12
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL B 1003
source : AC3

7) chain B
residue 13
type
ligand
sequence F
description BINDING SITE FOR RESIDUE CL B 1003
source : AC3

8) chain B
residue 54
type
ligand
sequence S
description BINDING SITE FOR RESIDUE CL B 1003
source : AC3

9) chain B
residue 55
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL B 1003
source : AC3

10) chain B
residue 321
type
ligand
sequence N
description BINDING SITE FOR RESIDUE CL B 1005
source : AC5

11) chain B
residue 324
type
ligand
sequence K
description BINDING SITE FOR RESIDUE CL B 1005
source : AC5

12) chain B
residue 325
type
ligand
sequence A
description BINDING SITE FOR RESIDUE CL B 1005
source : AC5

13) chain B
residue 12
type
ligand
sequence H
description BINDING SITE FOR RESIDUE CL B 1007
source : AC7

14) chain B
residue 59
type
ligand
sequence E
description BINDING SITE FOR RESIDUE CL B 1007
source : AC7

15) chain B
residue 182
type BINDING
ligand
sequence L
description NADP.
source Swiss-Prot : SWS_FT_FI3

16) chain B
residue 197
type BINDING
ligand
sequence N
description NADP.
source Swiss-Prot : SWS_FT_FI3

17) chain B
residue 221
type BINDING
ligand
sequence E
description NADP.
source Swiss-Prot : SWS_FT_FI3

18) chain B
residue 325
type BINDING
ligand
sequence A
description NADP.
source Swiss-Prot : SWS_FT_FI3

19) chain B
residue 156-159
type NP_BIND
ligand
sequence SVVG
description NADP.
source Swiss-Prot : SWS_FT_FI4

20) chain B
residue 243-249
type NP_BIND
ligand
sequence SVYNRMD
description NADP.
source Swiss-Prot : SWS_FT_FI4

21) chain B
residue 274-276
type NP_BIND
ligand
sequence RWQ
description NADP.
source Swiss-Prot : SWS_FT_FI4


Display surface

Download
Links