eF-site ID 1v3u-A PDB Code 1v3u Chain A click to enlarge Title Crystal structure of leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase in apo form Classification OXIDOREDUCTASE Compound leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase Source Cavia porcellus (Guinea pig) (Q9EQZ5_CAVPO) Sequence A:  FMVKAKSWTLKKPTQSDFELKTVELPPLKNGEVLLEALFL SVDPYMRIASKRLKEGAVMMGQQVARVVESKNSAFPAGSI VLAQSGWTTHFISDGKGLEKLLWPDKLPLSLALGTIGMPG LTAYFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKG CKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEALKKA SPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISLPP GPSPESIIYKQLRIEGFIVYRWQGDVREKALRDLMKWVLE GKIQYHEHVTKGFENMPAAFIEMLNGANLGKAVVTA Description Functional site 1) chain A residue 324 type sequence K description BINDING SITE FOR RESIDUE CL A 1001 source : AC1 2) chain A residue 325 type sequence A description BINDING SITE FOR RESIDUE CL A 1001 source : AC1 3) chain A residue 70 type sequence R description BINDING SITE FOR RESIDUE CL A 1004 source : AC4 4) chain A residue 72 type sequence V description BINDING SITE FOR RESIDUE CL A 1004 source : AC4 5) chain A residue 149 type sequence A description BINDING SITE FOR RESIDUE CL A 1006 source : AC6 6) chain A residue 151 type sequence A description BINDING SITE FOR RESIDUE CL A 1006 source : AC6 7) chain A residue 173 type sequence A description BINDING SITE FOR RESIDUE CL A 1006 source : AC6 8) chain A residue 178 type sequence K description BINDING SITE FOR RESIDUE CL A 1006 source : AC6 9) chain A residue 18 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q14914 source Swiss-Prot : SWS_FT_FI2 10) chain A residue 20 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:Q14914 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 152 type BINDING sequence G description BINDING => ECO:0000269|PubMed:15007077 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 178 type BINDING sequence K description BINDING => ECO:0000269|PubMed:15007077 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 193 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:15007077 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 217 type BINDING sequence N description BINDING => ECO:0000269|PubMed:15007077 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 239 type BINDING sequence C description BINDING => ECO:0000269|PubMed:15007077 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 270 type BINDING sequence F description BINDING => ECO:0000269|PubMed:15007077 source Swiss-Prot : SWS_FT_FI1 17) chain A residue 321 type BINDING sequence N description BINDING => ECO:0000269|PubMed:15007077 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 178 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:Q91YR9 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links