eF-site ID 1urk_13-A
PDB Code 1urk
Model 13
Chain A

click to enlarge
Title SOLUTION STRUCTURE OF THE AMINO TERMINAL FRAGMENT OF UROKINASE-TYPE PLASMINOGEN ACTIVATOR
Classification PLASMINOGEN ACTIVATION
Compound PLASMINOGEN ACTIVATOR
Source Homo sapiens (Human) (UROK_HUMAN)
Sequence A:  QVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEID
KSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYH
AHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQE
CMVHDCADGK
Description (1)  PLASMINOGEN ACTIVATOR (UROKINASE-TYPE) (AMINO TERMINAL FRAGMENT) (NMR, 15 STRUCTURES)


Functional site

1) chain A
residue 16
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FUC A 136
source : AC1

2) chain A
residue 17
type
ligand
sequence G
description BINDING SITE FOR RESIDUE FUC A 136
source : AC1

3) chain A
residue 18
type
ligand
sequence T
description BINDING SITE FOR RESIDUE FUC A 136
source : AC1

4) chain A
residue 31-42
type prosite
ligand
sequence CNCPKKFGGQHC
description EGF-like domain signature 1. C-x-C-x(2)-{V}-x(2)-G-{C}-x-C
source prosite : PS00022

5) chain A
residue 101-113
type prosite
ligand
sequence YCRNPDNRRRPWC
description Kringle domain signature. [FY]-C-[RH]-[NS]-x(7,8)-[WY]-C
source prosite : PS00021

6) chain A
residue 6-11
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence QVPSNC
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

7) chain A
residue 16-19
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence GGTC
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

8) chain A
residue 22-28
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence NKYFSNI
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

9) chain A
residue 32-34
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence NCP
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

10) chain A
residue 83-84
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence TY
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

11) chain A
residue 88-90
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence RSD
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

12) chain A
residue 92-94
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence LQL
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

13) chain A
residue 104-108
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence NPDNR
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

14) chain A
residue 110
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence R
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

15) chain A
residue 112
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence W
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

16) chain A
residue 125
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence E
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

17) chain A
residue 135
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence K
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

18) chain A
residue 12
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence D
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

19) chain A
residue 14-15
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence LN
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

20) chain A
residue 39-44
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence GQHCEI
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

21) chain A
residue 116-120
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence QVGLK
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

22) chain A
residue 35-38
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence KKFG
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

23) chain A
residue 45-50
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence DKSKTC
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

24) chain A
residue 58
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence Y
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

25) chain A
residue 62-66
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence ASTDT
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

26) chain A
residue 71
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence C
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

27) chain A
residue 101-103
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence YCR
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

28) chain A
residue 111
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence P
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

29) chain A
residue 113-114
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence CY
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

30) chain A
residue 122
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence L
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

31) chain A
residue 124
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence Q
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

32) chain A
residue 126-134
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence CMVHDCADG
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

33) chain A
residue 30
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence W
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

34) chain A
residue 57
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence F
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

35) chain A
residue 59-60
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence RG
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

36) chain A
residue 13
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence C
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

37) chain A
residue 20-21
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence VS
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

38) chain A
residue 29
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence H
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

39) chain A
residue 31
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence C
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

40) chain A
residue 54
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence N
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

41) chain A
residue 56
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence H
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

42) chain A
residue 61
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence K
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

43) chain A
residue 74
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence W
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

44) chain A
residue 91
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence A
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

45) chain A
residue 95-100
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence GLGKHN
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

46) chain A
residue 51-52
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence YE
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

47) chain A
residue 55
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence G
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

48) chain A
residue 67
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence M
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

49) chain A
residue 69
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence R
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

50) chain A
residue 109
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence R
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136

51) chain A
residue 123
type binding
ligand FUC: ALPHA-L-FUCOSE
sequence V
description ALPHA-L-FUCOSE binding site
source pdb_hetatom : FUC_1urk_A_136


Display surface

Download
Links