eF-site ID 1umf-A PDB Code 1umf Chain A click to enlarge Title crystal structure of chorismate synthase Classification LYASE Compound Chorismate synthase Source null (AROC_HELPY) Sequence A:  MNTLGRFLRLTTFGESHGDVIGGVLDGMPSGIKIDYALLE NEMKRRQGGRNVFITPRKEDDKVEITSGVFEDFSTGTPIG FLIHNQRARSKDYDNIKNLFRPSHADFTYFHKYGIRDFRG GGRSSARESAIRVAAGAFAKMLLREIGIVCESGIIEIGGI KAKNYDFNHALKSEIFALDEEQEEAQKTAIQNAIKNHDSI GGVALIRARSIKTNQKLPIGLGQGLYAKLDAKIAEAMMGL NGVKAVEIGKGVESSLLKGSEYNDLMDQKGFLSNRSGGVL GGMSNGEEIIVRVHFKPTPSIFQPQRTIDINGNECECLLK GRHDPCIAIRGSVVCESLLALVLADMVLLNLTSKIEYLKT IYNEN Description Functional site 1) chain A residue 46 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00300 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 241 type BINDING sequence N description BINDING => ECO:0000255|HAMAP-Rule:MF_00300 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 281 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00300 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 322 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00300 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 123 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00300, ECO:0000269|PubMed:15095868 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 296 type BINDING sequence K description BINDING => ECO:0000255|HAMAP-Rule:MF_00300, ECO:0000269|PubMed:15095868 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 14-29 type prosite sequence GESHGDVIGGVLDGMP description CHORISMATE_SYNTHASE_1 Chorismate synthase signature 1. GESHGdvIGgVLDGmP source prosite : PS00787 8) chain A residue 122-138 type prosite sequence GRSSARESAIRVAAGAF description CHORISMATE_SYNTHASE_2 Chorismate synthase signature 2. GrsSAReSairVaaGAF source prosite : PS00788 9) chain A residue 322-338 type prosite sequence RHDPCIAIRGSVVCESL description CHORISMATE_SYNTHASE_3 Chorismate synthase signature 3. RHDPCiairGsVVcESL source prosite : PS00789

Display surface Download Links