eF-site ID 1umd-A PDB Code 1umd Chain A click to enlarge Title branched-chain 2-oxo acid dehydrogenase (E1) from Thermus thermophilus HB8 with 4-methyl-2-oxopentanoate as an intermediate Classification OXIDOREDUCTASE Compound 2-oxo acid dehydrogenase alpha subunit Source Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) (ODBB_THET8) Sequence A:  HRFETFTEEPIRLIGEEGEWLGDFPLDLEGEKLRRLYRDM LAARMLDERYTILIRTGKTSFIAPAAGHEAAQVAIAHAIR PGFDWVFPYYRDHGLALALGIPLKELLGQMLATKADPNKG RQMPEHPGSKALNFFTVASPIASHVPPAAGAAISMKLLRT GQVAVCTFGDGATSEGDWYAGINFAAVQGAPAVFIAENNF YAISVDYRHQTHSPTIADKAHAFGIPGYLVDGMDVLASYY VVKEAVERARRGEGPSLVELRVYRYGPHSSADDDSRYRPK EEVAFWRKKDPIPRFRRFLEARGLWNEEWEEDVREEIRAE LERGLKEAEEAGPVPPEWMFEDVFAEKPWHLLRQEALLKE EL Description Functional site 1) chain A residue 175 type sequence D description BINDING SITE FOR RESIDUE MG A 1401 source : AC1 2) chain A residue 204 type sequence N description BINDING SITE FOR RESIDUE MG A 1401 source : AC1 3) chain A residue 206 type sequence Y description BINDING SITE FOR RESIDUE MG A 1401 source : AC1 4) chain A residue 94 type sequence Y description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 5) chain A residue 95 type sequence Y description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 6) chain A residue 96 type sequence R description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 7) chain A residue 144 type sequence S description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 8) chain A residue 145 type sequence P description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 9) chain A residue 146 type sequence I description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 10) chain A residue 174 type sequence G description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 11) chain A residue 175 type sequence D description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 12) chain A residue 176 type sequence G description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 13) chain A residue 177 type sequence A description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 14) chain A residue 180 type sequence E description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 15) chain A residue 204 type sequence N description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 16) chain A residue 206 type sequence Y description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 17) chain A residue 207 type sequence A description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 18) chain A residue 208 type sequence I description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 19) chain A residue 273 type sequence H description BINDING SITE FOR RESIDUE TPP A 1402 source : AC3 20) chain A residue 66 type sequence F description BINDING SITE FOR RESIDUE COI A 1403 source : AC4 21) chain A residue 144 type sequence S description BINDING SITE FOR RESIDUE COI A 1403 source : AC4 22) chain A residue 364-367 type prosite sequence KEEL description ER_TARGET Endoplasmic reticulum targeting sequence. KEEL source prosite : PS00014 23) chain A residue 273 type ACT_SITE sequence H description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 95 type ACT_SITE sequence Y description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 128 type ACT_SITE sequence M description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 144 type ACT_SITE sequence S description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 174 type ACT_SITE sequence G description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 175 type ACT_SITE sequence D description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 204 type ACT_SITE sequence N description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 206 type ACT_SITE sequence Y description Proton acceptor => ECO:0000305 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links