eF-site ID 1um1_4-A
PDB Code 1um1
Model 4
Chain A

click to enlarge
Title Solution Structure of RSGI RUH-007, PDZ domain in Human cDNA
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound KIAA1849 protein
Source Homo sapiens (Human) (K1849_HUMAN)
Sequence A:  GSSGSSGYVFTVELERGPSGLGMGLIDGMHTHLGAPGLYI
QTLLPGSPAAADGRLSLGDRILEVNGSSLLGLGYLRAVDL
IRHGGKKMRFLVAKSDVETAKKIHSGPSSG
Description (1)  KIAA1849 protein

Display surface

Download
Links