eF-site ID 1uj8-A
PDB Code 1uj8
Chain A

click to enlarge
Title Structures of ORF3 in Two Crystal Forms, a Member of Isc Machinery of E. coli Involved in the Assembly of Iron-Sulfur Clusters
Classification STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Compound Hypothetical protein yfhJ
Source Escherichia coli (strain K12) (ISCX_ECOLI)
Sequence A:  SHHHHHHGSGLKWTDSREIGEALYDAYPDLDPKTVRFTDM
HQWICDLEDFDDDPQASNEKILEAILLVWLDEA
Description (1)  Hypothetical protein yfhJ

Display surface

Download
Links