eF-site ID 1uhv-D
PDB Code 1uhv
Chain D

click to enlarge
Title Crystal structure of beta-D-xylosidase from Thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase
Classification HYDROLASE
Compound Beta-xylosidase
Source Thermoanaerobacter saccharolyticum (XYNB_THESA)
Sequence D:  MIKVRVPDFSDKKFSDRWRYCVGTGRLGLALQKEYIETLK
YVKENIDFKYIRGHGLLCDDVGIYREDVVGDEVKPFYNFT
YIDRIFDSFLEIGIRPFVEIGFMPKKLASGTQTVFYWEGN
VTPPKDYEKWSDLVKAVLHHFISRYGIEEVLKWPFEIWNE
PNLKEFWKDADEKEYFKLYKVTAKAIKEVNENLKVGGPAI
CGGADYWIEDFLNFCYEENVPVDFVSRHAYTSKQGEYTPH
LIYQEIMPSEYMLNEFKTVREIIKNSHFPNLPFHITEYNT
SYSPQNPVHDTPFNAAYIARILSEGGDYVDSFSYWTFSDV
FEERDVPRSQFHGGFGLVALNMIPKPTFYTFKFFNAMGEE
MLYRDEHMLVTRRDDGSVALIAWNEVMDKTENPDEDYEVE
IPVRFRDVFIKRQLIDEEHGNPWGTWIHMGRPRYPSKEQV
NTLREVAKPEIMTSQPVANDGYLNLKFKLGKNAVVLYELT
ERIDESSTYIGLDDSKINGY
Description (1)  Beta-xylosidase(E.C.3.2.1.37)


Functional site

1) chain D
residue 54
type
ligand
sequence H
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

2) chain D
residue 115
type
ligand
sequence F
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

3) chain D
residue 159
type
ligand
sequence N
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

4) chain D
residue 160
type
ligand
sequence E
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

5) chain D
residue 230
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

6) chain D
residue 277
type
ligand
sequence E
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

7) chain D
residue 282
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

8) chain D
residue 315
type
ligand
sequence W
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

9) chain D
residue 323
type
ligand
sequence E
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

10) chain D
residue 335
type
ligand
sequence F
description BINDING SITE FOR RESIDUE DFX D 3277
source : AC4

11) chain D
residue 160
type ACT_SITE
ligand
sequence E
description Proton donor (Potential).
source Swiss-Prot : SWS_FT_FI7

12) chain D
residue 277
type ACT_SITE
ligand
sequence E
description Nucleophile.
source Swiss-Prot : SWS_FT_FI8

13) chain D
residue 153-162
type prosite
ligand
sequence WPFEIWNEPN
description Glycosyl hydrolases family 39 active site. W-x-F-E-x-W-N-E-P-[DN]
source prosite : PS01027

14) chain D
residue 52
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence R
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

15) chain D
residue 54
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence H
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

16) chain D
residue 115
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence F
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

17) chain D
residue 159-160
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence NE
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

18) chain D
residue 166
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence F
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

19) chain D
residue 228
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence H
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

20) chain D
residue 230
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence Y
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

21) chain D
residue 277
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence E
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

22) chain D
residue 282
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence Y
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

23) chain D
residue 284
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence P
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

24) chain D
residue 315
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence W
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

25) chain D
residue 321
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence F
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

26) chain D
residue 323
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence E
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

27) chain D
residue 335
type binding
ligand DFX: 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE
sequence F
description 1,2-DEOXY-2-FLUORO-XYLOPYRANOSE binding site
source pdb_hetatom : DFX_1uhv_D_3277

28) chain D
residue 160
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1pz3
source CSA : CSA4

29) chain D
residue 277
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1pz3
source CSA : CSA8

30) chain D
residue 65
type catalytic
ligand
sequence R
description Annotated By Reference To The Literature 1pz3
source CSA : CSA8

31) chain D
residue 160
type catalytic
ligand
sequence E
description Annotated By Reference To The Literature 1pz3
source CSA : CSA8

32) chain D
residue 153
type catalytic
ligand
sequence W
description Annotated By Reference To The Literature 1pz3
source CSA : CSA12


Display surface

Download
Links