eF-site ID 1uhi-A PDB Code 1uhi Chain A click to enlarge Title Crystal structure of i-aequorin Classification LUMINESCENT PROTEIN Compound Aequorin 2 Source null (AEQ2_AEQVI) Sequence A:  ANSKLTSDFDNPRWIGRHKHMFNFLDVNHNGKISLDEMVY KASDIVINNLGATPEQAKRHKDAVEAFFGGAGMKYGVETD WPAYIEGWKKLATDELEKYAKNEPTLIRIWGDALFDIVDK DQNGAITLDEWKAYTKAAGIIQSSEDCEETFRVCDIDESG QLDVDEMTRQHLGFWYTMDPACEKLYGGAVP Description Functional site 1) chain A residue 16 type sequence H description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 2) chain A residue 19 type sequence M description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 3) chain A residue 82 type sequence Y description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 4) chain A residue 86 type sequence W description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 5) chain A residue 105 type sequence I description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 6) chain A residue 108 type sequence W description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 7) chain A residue 109 type sequence G description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 8) chain A residue 112 type sequence L description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 9) chain A residue 129 type sequence W description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 10) chain A residue 132 type sequence Y description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 11) chain A residue 166 type sequence T description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 12) chain A residue 169 type sequence H description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 13) chain A residue 173 type sequence W description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 14) chain A residue 184 type sequence Y description BINDING SITE FOR RESIDUE CZI A 1001 source : AC1 15) chain A residue 24-36 type prosite sequence DVNHNGKISLDEM description EF_HAND_1 EF-hand calcium-binding domain. DVNHNGKISldEM source prosite : PS00018 16) chain A residue 117-129 type prosite sequence DKDQNGAITLDEW description EF_HAND_1 EF-hand calcium-binding domain. DVNHNGKISldEM source prosite : PS00018 17) chain A residue 153-165 type prosite sequence DIDESGQLDVDEM description EF_HAND_1 EF-hand calcium-binding domain. DVNHNGKISldEM source prosite : PS00018 18) chain A residue 153 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 28 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 30 type BINDING sequence K description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 35 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 117 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 119 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 121 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 128 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 24 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 26 type BINDING sequence N description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 28) chain A residue 155 type BINDING sequence D description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 29) chain A residue 157 type BINDING sequence S description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 159 type BINDING sequence Q description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 31) chain A residue 164 type BINDING sequence E description BINDING => ECO:0000255|PROSITE-ProRule:PRU00448 source Swiss-Prot : SWS_FT_FI1 32) chain A residue 189 type SITE sequence P description Required for bioluminescence source Swiss-Prot : SWS_FT_FI2

Display surface Download Links