eF-site ID 1uh6_6-A
PDB Code 1uh6
Model 6
Chain A

click to enlarge
Title Solution Structure of the murine ubiquitin-like 5 protein from RIKEN cDNA 0610031K06
Classification Structural genomics, unknown function
Compound ubiquitin-like 5
Source Mus musculus (Mouse) (UBL5_MOUSE)
Sequence A:  MKGSSHHHHHHSSGASLVPRGSEGAATMIEVVCNDRLGKK
VRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKD
HVSLGDYEIHDGMNLELYYQ
Description (1)  ubiquitin-like 5

Display surface

Download
Links