eF-site ID 1ub3-D PDB Code 1ub3 Chain D click to enlarge Title Crystal Structure of Tetrameric Structure of Aldolase from thermus thermophilus HB8 Classification LYASE Compound Aldolase protein Source (Q7SIC8_THETH) Sequence D:  DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPS YVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALAC ARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVL KVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGA SLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASR LGTSSGVALVA Description Functional site 1) chain D residue 12 type sequence L description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 2) chain D residue 37 type sequence C description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 3) chain D residue 60 type sequence V description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 4) chain D residue 89 type sequence D description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 5) chain D residue 151 type sequence K description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 6) chain D residue 154 type sequence T description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 7) chain D residue 182 type sequence A description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 8) chain D residue 183 type sequence G description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 9) chain D residue 184 type sequence G description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 10) chain D residue 186 type sequence R description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 11) chain D residue 203 type sequence G description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 12) chain D residue 204 type sequence T description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 13) chain D residue 205 type sequence S description BINDING SITE FOR RESIDUE HPD D 804 source : AC4 14) chain D residue 89 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00114, ECO:0000305|PubMed:15388928 source Swiss-Prot : SWS_FT_FI1 15) chain D residue 180 type ACT_SITE sequence K description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00114, ECO:0000305|PubMed:15388928 source Swiss-Prot : SWS_FT_FI1 16) chain D residue 151 type ACT_SITE sequence K description Schiff-base intermediate with acetaldehyde => ECO:0000255|HAMAP-Rule:MF_00114, ECO:0000305|PubMed:15388928 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links