eF-site ID 1ub3-C PDB Code 1ub3 Chain C click to enlarge Title Crystal Structure of Tetrameric Structure of Aldolase from thermus thermophilus HB8 Classification LYASE Compound Aldolase protein Source (Q7SIC8_THETH) Sequence C:  DLAAHIDHTLLKPTATLEEVAKAAEEALEYGFYGLCIPPS YVAWVRARYPHAPFRLVTVVGFPLGYQEKEVKALEAALAC ARGADEVDMVLHLGRAKAGDLDYLEAEVRAVREAVPQAVL KVILETGYFSPEEIARLAEAAIRGGADFLKTSTGFGPRGA SLEDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASR LGTSSGVALV Description Functional site 1) chain C residue 12 type sequence L description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 2) chain C residue 37 type sequence C description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 3) chain C residue 60 type sequence V description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 4) chain C residue 151 type sequence K description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 5) chain C residue 154 type sequence T description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 6) chain C residue 155 type sequence G description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 7) chain C residue 182 type sequence A description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 8) chain C residue 183 type sequence G description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 9) chain C residue 184 type sequence G description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 10) chain C residue 186 type sequence R description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 11) chain C residue 203 type sequence G description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 12) chain C residue 204 type sequence T description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 13) chain C residue 205 type sequence S description BINDING SITE FOR RESIDUE HPD C 803 source : AC3 14) chain C residue 89 type ACT_SITE sequence D description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00114, ECO:0000305|PubMed:15388928 source Swiss-Prot : SWS_FT_FI1 15) chain C residue 180 type ACT_SITE sequence K description Proton donor/acceptor => ECO:0000255|HAMAP-Rule:MF_00114, ECO:0000305|PubMed:15388928 source Swiss-Prot : SWS_FT_FI1 16) chain C residue 151 type ACT_SITE sequence K description Schiff-base intermediate with acetaldehyde => ECO:0000255|HAMAP-Rule:MF_00114, ECO:0000305|PubMed:15388928 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links