eF-site ID 1u1g-E PDB Code 1u1g Chain E click to enlarge Title Structure of E. coli uridine phosphorylase complexed to 5-(m-(benzyloxy)benzyl)barbituric acid (BBBA) Classification TRANSFERASE Compound Uridine phosphorylase Source (UDP_ECOLI) Sequence E:  KSDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPV KLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELA QLGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLH FAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTF YPGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATL LTMCASQGLRAGMVAGVIVNRTQNAETMKQTESHAVKIVV EAARRLL Description Functional site 1) chain E residue 49 type sequence E description BINDING SITE FOR RESIDUE K E 1003 source : AC3 2) chain E residue 69 type sequence I description BINDING SITE FOR RESIDUE K E 1003 source : AC3 3) chain E residue 73 type sequence S description BINDING SITE FOR RESIDUE K E 1003 source : AC3 4) chain E residue 94 type sequence T description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 5) chain E residue 95 type sequence T description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 6) chain E residue 96 type sequence G description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 7) chain E residue 162 type sequence F description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 8) chain E residue 166 type sequence Q description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 9) chain E residue 168 type sequence R description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 10) chain E residue 195 type sequence Y description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 11) chain E residue 196 type sequence E description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 12) chain E residue 197 type sequence M description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 13) chain E residue 221 type sequence V description BINDING SITE FOR RESIDUE BBB E 7300 source : AC8 14) chain E residue 7 type sequence F description BINDING SITE FOR RESIDUE BBB F 8300 source : AC9 15) chain E residue 8 type sequence H description BINDING SITE FOR RESIDUE BBB F 8300 source : AC9 16) chain E residue 48 type sequence R description BINDING SITE FOR RESIDUE BBB F 8300 source : AC9 17) chain E residue 9 type catalytic sequence L description 787 source MCSA : MCSA5 18) chain E residue 81 type catalytic sequence L description 787 source MCSA : MCSA5 19) chain E residue 169 type catalytic sequence Y description 787 source MCSA : MCSA5 20) chain E residue 224 type catalytic sequence T description 787 source MCSA : MCSA5

Display surface Download Links