eF-site ID 1u1g-A PDB Code 1u1g Chain A click to enlarge Title Structure of E. coli uridine phosphorylase complexed to 5-(m-(benzyloxy)benzyl)barbituric acid (BBBA) Classification TRANSFERASE Compound Uridine phosphorylase Source (UDP_ECOLI) Sequence A:  SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVK LASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQ LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHF APLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFY PGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLL TMCASQGLRAGMVAGVIVNRTQAETMKQTESHAVKIVVEA ARRLL Description Functional site 1) chain A residue 49 type sequence E description BINDING SITE FOR RESIDUE K A 1002 source : AC2 2) chain A residue 69 type sequence I description BINDING SITE FOR RESIDUE K A 1002 source : AC2 3) chain A residue 73 type sequence S description BINDING SITE FOR RESIDUE K A 1002 source : AC2 4) chain A residue 94 type sequence T description BINDING SITE FOR RESIDUE BBB A 3300 source : AC4 5) chain A residue 95 type sequence T description BINDING SITE FOR RESIDUE BBB A 3300 source : AC4 6) chain A residue 96 type sequence G description BINDING SITE FOR RESIDUE BBB A 3300 source : AC4 7) chain A residue 162 type sequence F description BINDING SITE FOR RESIDUE BBB A 3300 source : AC4 8) chain A residue 166 type sequence Q description BINDING SITE FOR RESIDUE BBB A 3300 source : AC4 9) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE BBB A 3300 source : AC4 10) chain A residue 196 type sequence E description BINDING SITE FOR RESIDUE BBB A 3300 source : AC4 11) chain A residue 197 type sequence M description BINDING SITE FOR RESIDUE BBB A 3300 source : AC4 12) chain A residue 7 type sequence F description BINDING SITE FOR RESIDUE BBB B 4300 source : AC5 13) chain A residue 8 type sequence H description BINDING SITE FOR RESIDUE BBB B 4300 source : AC5 14) chain A residue 48 type sequence R description BINDING SITE FOR RESIDUE BBB B 4300 source : AC5 15) chain A residue 9 type catalytic sequence L description 787 source MCSA : MCSA1 16) chain A residue 81 type catalytic sequence L description 787 source MCSA : MCSA1 17) chain A residue 169 type catalytic sequence Y description 787 source MCSA : MCSA1 18) chain A residue 224 type catalytic sequence T description 787 source MCSA : MCSA1 19) chain A residue 66-81 type prosite sequence STGIGGPSTSIAVEEL description PNP_UDP_1 Purine and other phosphorylases family 1 signature. StGIGgPStSIaveEL source prosite : PS01232

Display surface Download Links