eF-site ID 1tyn-A PDB Code 1tyn Chain A click to enlarge Title ATOMIC STRUCTURE OF THE TRYPSIN-CYCLOTHEONAMIDE A COMPLEX: LESSONS FOR THE DESIGN OF SERINE PROTEASE INHIBITORS Classification HYDROLASE(SERINE PROTEASE) Compound BETA-TRYPSIN Source Bos taurus (Bovine) (TRY1_BOVIN) Sequence A:  IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAH CYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNT LNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISG WGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNM FCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQK NKPGVYTKVCNYVSWIKQTIASN Description (1)  BETA TRYPSIN COMPLEXED WITH CYCLOTHEONAMIDE A Functional site 1) chain A residue 41 type sequence F description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 2) chain A residue 57 type sequence H description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 3) chain A residue 189 type sequence D description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 4) chain A residue 190 type sequence S description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 5) chain A residue 191 type sequence C description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 6) chain A residue 192 type sequence Q description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 7) chain A residue 193 type sequence G description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 8) chain A residue 194 type sequence D description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 9) chain A residue 195 type sequence S description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 10) chain A residue 214 type sequence S description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 11) chain A residue 215 type sequence W description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 12) chain A residue 216 type sequence G description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 13) chain A residue 219 type sequence G description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 14) chain A residue 226 type sequence G description BINDING SITE FOR RESIDUE CTA A 246 source : AC1 15) chain A residue 73 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 75 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 17) chain A residue 78 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 18) chain A residue 83 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI2 19) chain A residue 192 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI2 20) chain A residue 195 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 198 type BINDING sequence P description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 60 type ACT_SITE sequence K description Charge relay system source Swiss-Prot : SWS_FT_FI1 23) chain A residue 105 type ACT_SITE sequence L description Charge relay system source Swiss-Prot : SWS_FT_FI1 24) chain A residue 198 type ACT_SITE sequence P description Charge relay system source Swiss-Prot : SWS_FT_FI1 25) chain A residue 53-58 type prosite sequence VSAAHC description TRYPSIN_HIS Serine proteases, trypsin family, histidine active site. VSAAHC source prosite : PS00134 26) chain A residue 189-200 type prosite sequence DSCQGDSGGPVV description TRYPSIN_SER Serine proteases, trypsin family, serine active site. DScqGDSGGPVV source prosite : PS00135

Display surface Download Links