eF-site ID 1tyf-A PDB Code 1tyf Chain A click to enlarge Title THE STRUCTURE OF CLPP AT 2.3 ANGSTROM RESOLUTION SUGGESTS A MODEL FOR ATP-DEPENDENT PROTEOLYSIS Classification PEPTIDASE Compound CLP PEPTIDASE Source Escherichia coli (strain K12) (CLPP_ECOLI) Sequence A:  SRGERSFDIYSRLLKERVIFLTGQVEDHMANLIVAQMLFL EAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQG QATDIEIHAREILKVKGRMNELMALHTGQSLEQIERDTER DRFLSAPEAVEYGLVDSILTHRN Description Functional site 1) chain A residue 68 type catalytic sequence G description 912 source MCSA : MCSA1 2) chain A residue 97 type catalytic sequence S description 912 source MCSA : MCSA1 3) chain A residue 98 type catalytic sequence M description 912 source MCSA : MCSA1 4) chain A residue 122 type catalytic sequence H description 912 source MCSA : MCSA1 5) chain A residue 171 type catalytic sequence D description 912 source MCSA : MCSA1 6) chain A residue 97 type ACT_SITE sequence S description Nucleophile => ECO:0000305 source Swiss-Prot : SWS_FT_FI1 7) chain A residue 122 type ACT_SITE sequence H description ACT_SITE => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 8) chain A residue 171 type ACT_SITE sequence D description ACT_SITE => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 89-100 type prosite sequence TICMGQAASMGA description CLP_PROTEASE_SER Endopeptidase Clp serine active site. TicMGqAASMGA source prosite : PS00381 10) chain A residue 111-124 type prosite sequence RFCLPNSRVMIHQP description CLP_PROTEASE_HIS Endopeptidase Clp histidine active site. RfclPnsrVMIHQP source prosite : PS00382

Display surface Download Links