eF-site ID 1txx-A PDB Code 1txx Chain A click to enlarge Title ACTIVE-SITE VARIANT OF E.COLI THIOREDOXIN Classification OXIDOREDUCTASE Compound PROTEIN (THIOREDOXIN) Source Escherichia coli (strain K12) (THIO_ECOLI) Sequence A:  SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCVWCKMIAP ILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLL FKNGEVAATKVGALSKGQLKEFLDANLA Description Functional site 1) chain A residue 1 type sequence S description BINDING SITE FOR RESIDUE CU A 109 source : AC1 2) chain A residue 2 type sequence D description BINDING SITE FOR RESIDUE CU A 109 source : AC1 3) chain A residue 24-42 type prosite sequence LVDFWAEWCVWCKMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCVWCKmIapiL source prosite : PS00194 4) chain A residue 32 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 5) chain A residue 35 type ACT_SITE sequence C description Nucleophile source Swiss-Prot : SWS_FT_FI1 6) chain A residue 26 type SITE sequence D description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 7) chain A residue 33 type SITE sequence V description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 8) chain A residue 34 type SITE sequence W description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 9) chain A residue 69 type MOD_RES sequence K description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links