eF-site ID 1tvw-A PDB Code 1tvw Chain A click to enlarge Title CONTRIBUTIONS OF ORIENTATION AND HYDROGEN BONDING TO CATALYSIS IN ASN-229 MUTANTS OF THYMIDYLATE SYNTHASE Classification TRANSFERASE Compound THYMIDYLATE SYNTHASE Source Lactobacillus casei (TYSY_LACCA) Sequence A:  MLEQPYLDLAKKVLDEGHFKPDRTHTGTYSIFGHQMRFDL SKGFPLLTTKKVPFGLIKSELLWFLHGDTNIRFLLQHRNH IWDEWAFEKWVKSDEYHGPDMTDFGHRSQKDPEFAAVYHE EMAKFDDRVLHDDAFAAKYGDLGLVYGSQWRAWHTSKGDT IDQLGDVIEQIKTHPYSRRLIVSAWNPEDVPTMALPPCHT LYQFYVNDGKLSLQLYQRSADIFLGVPFSIASYALLTHLV AHECGLEVGEFIHTFGDAHLYVNHLDQIKEQLSRTPRPAP TLQLNPDKHDIFDFDMKDIKLLNYDPYPAIKAPVAV Description Functional site 1) chain A residue 198 type sequence C description CATALYTIC CYSTEINE. source : CAT 2) chain A residue 23 type sequence R description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 3) chain A residue 178 type sequence R description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 4) chain A residue 179 type sequence R description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 5) chain A residue 195 type sequence L description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 6) chain A residue 198 type sequence C description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 7) chain A residue 199 type sequence H description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 8) chain A residue 218 type sequence R description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 9) chain A residue 219 type sequence S description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 10) chain A residue 221 type sequence D description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 11) chain A residue 259 type sequence H description BINDING SITE FOR RESIDUE UMP A 317 source : AC1 12) chain A residue 50 type sequence K description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 13) chain A residue 81 type sequence I description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 14) chain A residue 221 type sequence D description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 15) chain A residue 224 type sequence L description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 16) chain A residue 228 type sequence F description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 17) chain A residue 261 type sequence Y description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 18) chain A residue 312 type sequence A description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 19) chain A residue 313 type sequence P description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 20) chain A residue 314 type sequence V description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 21) chain A residue 315 type sequence A description BINDING SITE FOR RESIDUE CB3 A 318 source : AC2 22) chain A residue 60 type catalytic sequence E description 31 source MCSA : MCSA1 23) chain A residue 82 type catalytic sequence W description 31 source MCSA : MCSA1 24) chain A residue 146 type catalytic sequence Y description 31 source MCSA : MCSA1 25) chain A residue 198 type catalytic sequence C description 31 source MCSA : MCSA1 26) chain A residue 218 type catalytic sequence R description 31 source MCSA : MCSA1 27) chain A residue 221 type catalytic sequence D description 31 source MCSA : MCSA1 28) chain A residue 178-206 type prosite sequence RRLIVSAWNPEDVPTMALPPCHTLYQFYV description THYMIDYLATE_SYNTHASE Thymidylate synthase active site. RrlIvsaWNpedvptma.....LpPCHtlyQFyV source prosite : PS00091 29) chain A residue 198 type ACT_SITE sequence C description Nucleophile => ECO:0000255|HAMAP-Rule:MF_00008 source Swiss-Prot : SWS_FT_FI1 30) chain A residue 23 type BINDING sequence R description in other chain => ECO:0000255|HAMAP-Rule:MF_00008 source Swiss-Prot : SWS_FT_FI2 31) chain A residue 218 type BINDING sequence R description in other chain => ECO:0000255|HAMAP-Rule:MF_00008 source Swiss-Prot : SWS_FT_FI2 32) chain A residue 229 type BINDING sequence S description in other chain => ECO:0000255|HAMAP-Rule:MF_00008 source Swiss-Prot : SWS_FT_FI2 33) chain A residue 259 type BINDING sequence H description in other chain => ECO:0000255|HAMAP-Rule:MF_00008 source Swiss-Prot : SWS_FT_FI2 34) chain A residue 178 type BINDING sequence R description BINDING => ECO:0000255|HAMAP-Rule:MF_00008 source Swiss-Prot : SWS_FT_FI3 35) chain A residue 221 type BINDING sequence D description BINDING => ECO:0000255|HAMAP-Rule:MF_00008 source Swiss-Prot : SWS_FT_FI3 36) chain A residue 315 type BINDING sequence A description BINDING => ECO:0000255|HAMAP-Rule:MF_00008 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links