eF-site ID 1tsq-A PDB Code 1tsq Chain A click to enlarge Title CRYSTAL STRUCTURE OF AP2V SUBSTRATE VARIANT OF NC-P1 DECAMER PEPTIDE IN COMPLEX WITH V82A/D25N HIV-1 PROTEASE MUTANT Classification hydrolase/viral protein Compound Pol polyprotein Source (GAG_HV1H2) Sequence A:  PQITLWKRPLVTIRIGGQLKEALLNTGADDTVLEEMNLPG KWKPKMIGGIGGFIKVRQYDQIPVEICGHKAIGTVLVGPT PANIIGRNLLTQIGCTLNF Description Functional site 1) chain A residue 1 type sequence P description BINDING SITE FOR RESIDUE ACT B 501 source : AC1 2) chain A residue 2 type sequence Q description BINDING SITE FOR RESIDUE ACT A 503 source : AC3 3) chain A residue 14 type sequence R description BINDING SITE FOR RESIDUE ACT A 503 source : AC3 4) chain A residue 20 type sequence K description BINDING SITE FOR RESIDUE ACT A 504 source : AC4 5) chain A residue 21 type sequence E description BINDING SITE FOR RESIDUE ACT A 504 source : AC4 6) chain A residue 83 type sequence N description BINDING SITE FOR RESIDUE ACT A 504 source : AC4 7) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE ACT A 506 source : AC6 8) chain A residue 36 type sequence M description BINDING SITE FOR RESIDUE ACT A 507 source : AC7 9) chain A residue 37 type sequence N description BINDING SITE FOR RESIDUE ACT A 507 source : AC7 10) chain A residue 14 type sequence R description BINDING SITE FOR RESIDUE ACT B 508 source : AC8 11) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE ACT B 508 source : AC8 12) chain A residue 17 type sequence G description BINDING SITE FOR RESIDUE ACT B 508 source : AC8 13) chain A residue 39 type sequence P description BINDING SITE FOR RESIDUE ACT B 510 source : BC1 14) chain A residue 40 type sequence G description BINDING SITE FOR RESIDUE ACT B 510 source : BC1 15) chain A residue 78 type MOD_RES sequence G description Phosphotyrosine; by host => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links