eF-site ID 1tru_4-A PDB Code 1tru Model 4 Chain A click to enlarge Title THE HIGH-RESOLUTION THREE-DIMENSIONAL SOLUTION STRUCTURES OF THE OXIDIZED AND REDUCED STATES OF HUMAN THIOREDOXIN Classification ELECTRON TRANSPORT Compound THIOREDOXIN Source Homo sapiens (Human) (THIO_HUMAN) Sequence A:  MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKP FFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFF KKGQKVGEFSGANKEKLEATINELV Description Functional site 1) chain A residue 32 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:9108029 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 35 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:9108029 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 62 type MOD_RES sequence A description S-nitrosocysteine => ECO:0000269|PubMed:17260951 source Swiss-Prot : SWS_FT_FI6 4) chain A residue 69 type MOD_RES sequence A description S-nitrosocysteine => ECO:0000269|PubMed:17260951 source Swiss-Prot : SWS_FT_FI6 5) chain A residue 73 type MOD_RES sequence A description S-nitrosocysteine; alternate => ECO:0000269|PubMed:16408020, ECO:0000269|PubMed:17606900 source Swiss-Prot : SWS_FT_FI7 6) chain A residue 94 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P10639 source Swiss-Prot : SWS_FT_FI8 7) chain A residue 24-42 type prosite sequence VVDFSATWCGPCKMIKPFF description THIOREDOXIN_1 Thioredoxin family active site. VVdFSatWCGPCKmIkpfF source prosite : PS00194 8) chain A residue 26 type SITE sequence D description Deprotonates C-terminal active site Cys => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 9) chain A residue 33 type SITE sequence G description Contributes to redox potential value => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 10) chain A residue 34 type SITE sequence P description Contributes to redox potential value => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 11) chain A residue 3 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 12) chain A residue 39 type MOD_RES sequence K description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 13) chain A residue 8 type MOD_RES sequence K description N6-succinyllysine => ECO:0000250|UniProtKB:P10639 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links