eF-site ID 1tru_14-A PDB Code 1tru Model 14 Chain A click to enlarge Title THE HIGH-RESOLUTION THREE-DIMENSIONAL SOLUTION STRUCTURES OF THE OXIDIZED AND REDUCED STATES OF HUMAN THIOREDOXIN Classification ELECTRON TRANSPORT Compound THIOREDOXIN Source Homo sapiens (Human) (THIO_HUMAN) Sequence A:  MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKP FFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFF KKGQKVGEFSGANKEKLEATINELV Description Functional site 1) chain A residue 24-42 type prosite sequence VVDFSATWCGPCKMIKPFF description THIOREDOXIN_1 Thioredoxin family active site. VVdFSatWCGPCKmIkpfF source prosite : PS00194 2) chain A residue 33 type ACT_SITE sequence G description Nucleophile => ECO:0000269|PubMed:9108029 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 36 type ACT_SITE sequence K description Nucleophile => ECO:0000269|PubMed:9108029 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 5) chain A residue 34 type SITE sequence P description Contributes to redox potential value => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 6) chain A residue 35 type SITE sequence C description Contributes to redox potential value => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 4 type MOD_RES sequence Q description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 8) chain A residue 40 type MOD_RES sequence P description N6-acetyllysine => ECO:0007744|PubMed:19608861 source Swiss-Prot : SWS_FT_FI4 9) chain A residue 9 type MOD_RES sequence T description N6-succinyllysine => ECO:0000250|UniProtKB:P10639 source Swiss-Prot : SWS_FT_FI5 10) chain A residue 63 type MOD_RES sequence Q description S-nitrosocysteine => ECO:0000269|PubMed:17260951 source Swiss-Prot : SWS_FT_FI6 11) chain A residue 70 type MOD_RES sequence E description S-nitrosocysteine => ECO:0000269|PubMed:17260951 source Swiss-Prot : SWS_FT_FI6 12) chain A residue 74 type MOD_RES sequence T description S-nitrosocysteine; alternate => ECO:0000269|PubMed:16408020, ECO:0000269|PubMed:17606900 source Swiss-Prot : SWS_FT_FI7 13) chain A residue 95 type MOD_RES sequence E description N6-succinyllysine; alternate => ECO:0000250|UniProtKB:P10639 source Swiss-Prot : SWS_FT_FI8

Display surface Download Links