eF-site ID 1tq4-A PDB Code 1tq4 Chain A click to enlarge Title Crystal Structure of IIGP1: a paradigm for interferon inducible p47 resistance GTPases Classification SIGNALING PROTEIN Compound interferon-inducible GTPase Source null (IIGP1_MOUSE) Sequence A:  NDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRAGNIQL TNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIG NEEEGAAKTGVMERHPYKHPNIPNVVFWDLPGIGSTNFPP DTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKE FYFVRTKVDSDITNEADGEPQTFDKEKVLQDIRLNCVNTF RENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRH NFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPS LTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIE VDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYL LPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN Description Functional site 1) chain A residue 82 type sequence K description BINDING SITE FOR RESIDUE MG A 501 source : AC1 2) chain A residue 83 type sequence S description BINDING SITE FOR RESIDUE MG A 501 source : AC1 3) chain A residue 126 type sequence D description BINDING SITE FOR RESIDUE MG A 501 source : AC1 4) chain A residue 77 type sequence E description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 5) chain A residue 79 type sequence G description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 6) chain A residue 80 type sequence S description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 7) chain A residue 81 type sequence G description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 8) chain A residue 82 type sequence K description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 9) chain A residue 83 type sequence S description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 10) chain A residue 84 type sequence S description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 11) chain A residue 102 type sequence T description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 12) chain A residue 103 type sequence G description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 13) chain A residue 184 type sequence K description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 14) chain A residue 186 type sequence D description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 15) chain A residue 231 type sequence S description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 16) chain A residue 232 type sequence N description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 17) chain A residue 233 type sequence K description BINDING SITE FOR RESIDUE GDP A 500 source : AC2 18) chain A residue 103 type BINDING sequence G description BINDING => ECO:0000269|PubMed:12732635 source Swiss-Prot : SWS_FT_FI1 19) chain A residue 184 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12732635 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 186 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12732635 source Swiss-Prot : SWS_FT_FI1 21) chain A residue 232 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12732635 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 79 type BINDING sequence G description BINDING => ECO:0000269|PubMed:12732635 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 81 type BINDING sequence G description BINDING => ECO:0000269|PubMed:12732635 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 82 type BINDING sequence K description BINDING => ECO:0000269|PubMed:12732635 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 83 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12732635 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links