eF-site ID 1tmj-A PDB Code 1tmj Chain A click to enlarge Title Crystal structure of E.coli apo-HPPK(W89A) at 1.45 Angstrom resolution Classification TRANSFERASE Compound 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase Source Escherichia coli (strain K12) (HPPK_ECOLI) Sequence A:  TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFY RTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQ GRVRKAERAGPRTLDLDIMLFGNEVINTERLTVPHYDMKN RGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW Description Functional site 1) chain A residue 95 type sequence D description BINDING SITE FOR RESIDUE MG A 161 source : AC1 2) chain A residue 97 type sequence D description BINDING SITE FOR RESIDUE MG A 161 source : AC1 3) chain A residue 95 type sequence D description BINDING SITE FOR RESIDUE MG A 162 source : AC2 4) chain A residue 97 type sequence D description BINDING SITE FOR RESIDUE MG A 162 source : AC2 5) chain A residue 114 type sequence P description BINDING SITE FOR RESIDUE CL A 163 source : AC3 6) chain A residue 119 type sequence K description BINDING SITE FOR RESIDUE CL A 163 source : AC3 7) chain A residue 137 type sequence F description BINDING SITE FOR RESIDUE CL A 163 source : AC3 8) chain A residue 138 type sequence P description BINDING SITE FOR RESIDUE CL A 163 source : AC3 9) chain A residue 139 type sequence D description BINDING SITE FOR RESIDUE CL A 163 source : AC3 10) chain A residue 83 type catalytic sequence V description 151 source MCSA : MCSA1 11) chain A residue 93 type catalytic sequence T description 151 source MCSA : MCSA1 12) chain A residue 96 type catalytic sequence L description 151 source MCSA : MCSA1 13) chain A residue 98 type catalytic sequence I description 151 source MCSA : MCSA1 14) chain A residue 88-99 type prosite sequence RAGPRTLDLDIM description HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase signature. RaGPRtlDLDIM source prosite : PS00794

Display surface Download Links