eF-site ID 1tkd-B PDB Code 1tkd Chain B click to enlarge Title T7 DNA polymerase ternary complex with 8 oxo guanosine and dCMP at the elongation site Classification TRANSFERASE/ELECTRON TRANSPORT/DNA Compound DNA (5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*CP*GP*GP*CP*CP*AP*GP*TP*GP*CP*CP*AP*(DOC))-3') Source Enterobacteria phage T7 (Bacteriophage T7) (1TKD) Sequence B:  KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPIL DEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFK NGEVAATKVGALSKGQLKEFLDANL Description Functional site 1) chain B residue 5 type sequence I description BINDING SITE FOR RESIDUE MES A 991 source : AC8 2) chain B residue 6 type sequence H description BINDING SITE FOR RESIDUE MES A 991 source : AC8 3) chain B residue 11 type sequence S description BINDING SITE FOR RESIDUE MES A 991 source : AC8 4) chain B residue 14 type sequence T description BINDING SITE FOR RESIDUE MES A 991 source : AC8 5) chain B residue 15 type sequence D description BINDING SITE FOR RESIDUE MES A 991 source : AC8 6) chain B residue 24-42 type prosite sequence LVDFWAEWCGPCKMIAPIL description THIOREDOXIN_1 Thioredoxin family active site. LVdFWaeWCGPCKmIapiL source prosite : PS00194 7) chain B residue 33 type ACT_SITE sequence G description Nucleophile source Swiss-Prot : SWS_FT_FI1 8) chain B residue 36 type ACT_SITE sequence K description Nucleophile source Swiss-Prot : SWS_FT_FI1 9) chain B residue 27 type SITE sequence F description Deprotonates C-terminal active site Cys source Swiss-Prot : SWS_FT_FI2 10) chain B residue 34 type SITE sequence P description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 11) chain B residue 35 type SITE sequence C description Contributes to redox potential value source Swiss-Prot : SWS_FT_FI3 12) chain B residue 70 type MOD_RES sequence Y description N6-acetyllysine => ECO:0000269|PubMed:18723842 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links