eF-site ID 1til-A PDB Code 1til Chain A click to enlarge Title Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA:Poised for phosphorylation complex with ATP, crystal form II Classification TRANSCRIPTION Compound Anti-sigma F factor Source Geobacillus stearothermophilus (Bacillus stearothermophilus) (SP2AA_BACST) Sequence A:  MRNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEI KTVVSEAVTNAIIHGYNNDPNGIVSISVIIEDGVVHLTVR DEGVGIPDIEEARQPLFTTKPELERSGMGFTIMENFMDEV IVESEVNKGTTVYLKKHIVKS Description Functional site 1) chain A residue 46 type sequence E description BINDING SITE FOR RESIDUE MG A 300 source : AC1 2) chain A residue 50 type sequence N description BINDING SITE FOR RESIDUE MG A 300 source : AC1 3) chain A residue 46 type sequence E description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 4) chain A residue 50 type sequence N description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 5) chain A residue 51 type sequence A description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 6) chain A residue 54 type sequence H description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 7) chain A residue 55 type sequence G description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 8) chain A residue 81 type sequence D description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 9) chain A residue 85 type sequence G description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 10) chain A residue 86 type sequence I description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 11) chain A residue 92 type sequence A description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 12) chain A residue 98 type sequence T description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 13) chain A residue 99 type sequence T description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 14) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 15) chain A residue 106 type sequence S description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 16) chain A residue 107 type sequence G description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 17) chain A residue 108 type sequence M description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 18) chain A residue 109 type sequence G description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 19) chain A residue 110 type sequence F description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 20) chain A residue 130 type sequence T description BINDING SITE FOR RESIDUE ATP A 200 source : AC4 21) chain A residue 46 type catalytic sequence E description 760 source MCSA : MCSA1 22) chain A residue 50 type catalytic sequence N description 760 source MCSA : MCSA1 23) chain A residue 105 type catalytic sequence R description 760 source MCSA : MCSA1

Display surface Download Links