eF-site ID 1tig-A
PDB Code 1tig
Chain A

click to enlarge
Title TRANSLATION INITIATION FACTOR 3 C-TERMINAL DOMAIN
Classification RIBOSOME BINDING FACTOR
Compound TRANSLATION INITIATION FACTOR 3
Source Geobacillus stearothermophilus (Bacillus stearothermophilus) (IF3_BACST)
Sequence A:  INVKEVRLSPTIEEHDFNTKLRNARKFLEKGDKVKATIRF
KGRAITHKEIGQRVLDRLSEACADIAVVETAPKMDGRNMF
LVLAPKND
Description (1)  TRANSLATION INITIATION FACTOR 3

Display surface

Download
Links