eF-site ID 1thn-A PDB Code 1thn Chain A click to enlarge Title Crystal Structures of the ADP and ATP bound forms of the Bacillus Anti-sigma factor SpoIIAB in complex with the Anti-anti-sigma SpoIIAA: inhibitory complex with ADP, crystal form I Classification TRANSCRIPTION Compound Anti-sigma F factor Source Geobacillus stearothermophilus (Bacillus stearothermophilus) (SP2AA_BACST) Sequence A:  RNEMHLQFSARSENESFARVTVAAFVAQLDPTMDELTEIK TVVSEAVTNAIIHGYNNDPNGIVSISVIIEDGVVHLTVRD EGVGIPDIEEARQPLFTTKPELERSGMGFTIMENFMDEVI VESEVNKGTTVYLKKH Description Functional site 1) chain A residue 50 type sequence N description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 2) chain A residue 54 type sequence H description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 3) chain A residue 55 type sequence G description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 4) chain A residue 85 type sequence G description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 5) chain A residue 92 type sequence A description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 6) chain A residue 97 type sequence F description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 7) chain A residue 98 type sequence T description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 8) chain A residue 99 type sequence T description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 9) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 10) chain A residue 106 type sequence S description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 11) chain A residue 107 type sequence G description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 12) chain A residue 109 type sequence G description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 13) chain A residue 110 type sequence F description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 14) chain A residue 130 type sequence T description BINDING SITE FOR RESIDUE ADP A 200 source : AC1 15) chain A residue 29 type sequence Q description BINDING SITE FOR RESIDUE DMF A 201 source : AC3 16) chain A residue 46 type catalytic sequence E description 760 source MCSA : MCSA1 17) chain A residue 50 type catalytic sequence N description 760 source MCSA : MCSA1 18) chain A residue 105 type catalytic sequence R description 760 source MCSA : MCSA1

Display surface Download Links