eF-site ID 1tgv-A PDB Code 1tgv Chain A click to enlarge Title Structure of E. coli Uridine Phosphorylase complexed with 5-Fluorouridine and sulfate Classification TRANSFERASE Compound uridine phosphorylase Source null (UDP_ECOLI) Sequence A:  SDVFHLGLTKNDLQGATLAIVPGDPDRVEKIAALMDKPVK LASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQ LGIRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHF APLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFY PGQERYDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLL TMCASQGLRAGMVAGVIVNRTQQEIPNAETMKQTESHAVK IVVEAARRLL Description Functional site 1) chain A residue 26 type sequence G description BINDING SITE FOR RESIDUE SO4 A 482 source : AC1 2) chain A residue 30 type sequence R description BINDING SITE FOR RESIDUE SO4 A 482 source : AC1 3) chain A residue 91 type sequence R description BINDING SITE FOR RESIDUE SO4 A 482 source : AC1 4) chain A residue 92 type sequence I description BINDING SITE FOR RESIDUE SO4 A 482 source : AC1 5) chain A residue 93 type sequence G description BINDING SITE FOR RESIDUE SO4 A 482 source : AC1 6) chain A residue 94 type sequence T description BINDING SITE FOR RESIDUE SO4 A 482 source : AC1 7) chain A residue 48 type sequence R description BINDING SITE FOR RESIDUE SO4 B 682 source : AC2 8) chain A residue 49 type sequence E description BINDING SITE FOR RESIDUE K A 1001 source : AC3 9) chain A residue 69 type sequence I description BINDING SITE FOR RESIDUE K A 1001 source : AC3 10) chain A residue 73 type sequence S description BINDING SITE FOR RESIDUE K A 1001 source : AC3 11) chain A residue 91 type sequence R description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 12) chain A residue 94 type sequence T description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 13) chain A residue 95 type sequence T description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 14) chain A residue 96 type sequence G description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 15) chain A residue 162 type sequence F description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 16) chain A residue 166 type sequence Q description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 17) chain A residue 168 type sequence R description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 18) chain A residue 196 type sequence E description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 19) chain A residue 197 type sequence M description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 20) chain A residue 198 type sequence E description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 21) chain A residue 220 type sequence I description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 22) chain A residue 221 type sequence V description BINDING SITE FOR RESIDUE 5UD A 3001 source : AC4 23) chain A residue 8 type sequence H description BINDING SITE FOR RESIDUE 5UD B 5002 source : AC5 24) chain A residue 8 type catalytic sequence H description 787 source MCSA : MCSA1 25) chain A residue 80 type catalytic sequence E description 787 source MCSA : MCSA1 26) chain A residue 168 type catalytic sequence R description 787 source MCSA : MCSA1 27) chain A residue 223 type catalytic sequence R description 787 source MCSA : MCSA1 28) chain A residue 66-81 type prosite sequence STGIGGPSTSIAVEEL description PNP_UDP_1 Purine and other phosphorylases family 1 signature. StGIGgPStSIaveEL source prosite : PS01232

Display surface Download Links