eF-site ID 1t1p_8-AB
PDB Code 1t1p
Model 8
Chain A, B

click to enlarge
Title NMR STRUCTURE OF HUMAN INSULIN MUTANT HIS-B10-ASP, VAL-B12-THR, PRO-B28-LYS, LYS-B29-PRO, 15 STRUCTURES
Classification HORMONE/GROWTH FACTOR
Compound insulin
Source Homo sapiens (Human) (INS_HUMAN)
Sequence A:  GIVEQCCTSICSLYQLENYCN
B:  FVNQHLCGSDLTEALYLVCGERGFFYTKPT
Description (1)  insulin, Insulin

Display surface

Download
Links