eF-site ID 1t19_1-A PDB Code 1t19 Model 1 Chain A click to enlarge Title Early intermediate IE2 from time-resolved crystallography of the E46Q mutant of PYP Classification photoreceptor Compound Photoactive yellow protein Source null (PYP_ECTHA) Sequence A:  MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNIL QYNAAQGDITGRDPKQVIGKNFFKDVAPCTDSPEFYGKFK EGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWV FVKRV Description Functional site 1) chain A residue 42 type sequence Y description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 2) chain A residue 52 type sequence R description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 3) chain A residue 62 type sequence F description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 4) chain A residue 66 type sequence V description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 5) chain A residue 67 type sequence A description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 6) chain A residue 68 type sequence P description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 7) chain A residue 69 type sequence C description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 8) chain A residue 70 type sequence T description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 9) chain A residue 96 type sequence F description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 10) chain A residue 98 type sequence Y description BINDING SITE FOR RESIDUE HC4 A 169 source : AC1 11) chain A residue 69 type MOD_RES sequence C description S-(4-hydroxycinnamyl)cysteine => ECO:0000269|PubMed:7981196 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links