eF-site ID 1sub-A PDB Code 1sub Chain A click to enlarge Title CALCIUM-INDEPENDENT SUBTILISIN BY DESIGN Classification HYDROLASE(SERINE PROTEINASE) Compound SUBTILISIN BPN' CRB-S3 Source Bacillus amyloliquefaciens (Bacillus velezensis) (SUBT_BACAM) Sequence A:  AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHP DLKVAGGASMVPSETNPFQDNNSHGTHVAGTVAALNNSIG VLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMD VINMSLGGPSGSAALKAAVDKAVASGVVVVAAAGNEGTSG SSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMA PGVSIQSTLPGNKYGAYSGTXMASPHVAGAAALILSKHPN WTNTQVRSSLENTTTKLGDSFYYGKGLINVQAAAQ Description Functional site 1) chain A residue 32 type sequence D description ACTIVE SITE, THE CATALYTIC TRIAD source : ACT 2) chain A residue 64 type sequence H description ACTIVE SITE, THE CATALYTIC TRIAD source : ACT 3) chain A residue 221 type sequence X description ACTIVE SITE, THE CATALYTIC TRIAD source : ACT 4) chain A residue 2 type sequence Q description BINDING SITE FOR RESIDUE CA A 295 source : AC1 5) chain A residue 41 type sequence D description BINDING SITE FOR RESIDUE CA A 295 source : AC1 6) chain A residue 75 type sequence L description BINDING SITE FOR RESIDUE CA A 295 source : AC1 7) chain A residue 77 type sequence N description BINDING SITE FOR RESIDUE CA A 295 source : AC1 8) chain A residue 79 type sequence I description BINDING SITE FOR RESIDUE CA A 295 source : AC1 9) chain A residue 81 type sequence V description BINDING SITE FOR RESIDUE CA A 295 source : AC1 10) chain A residue 169 type sequence G description BINDING SITE FOR RESIDUE K A 297 source : AC2 11) chain A residue 171 type sequence Y description BINDING SITE FOR RESIDUE K A 297 source : AC2 12) chain A residue 174 type sequence V description BINDING SITE FOR RESIDUE K A 297 source : AC2 13) chain A residue 195 type sequence E description BINDING SITE FOR RESIDUE K A 297 source : AC2 14) chain A residue 197 type sequence D description BINDING SITE FOR RESIDUE K A 297 source : AC2 15) chain A residue 37 type sequence S description BINDING SITE FOR RESIDUE ACN A 298 source : AC3 16) chain A residue 58 type sequence F description BINDING SITE FOR RESIDUE ACN A 298 source : AC3 17) chain A residue 186 type sequence R description BINDING SITE FOR RESIDUE ACN A 298 source : AC3 18) chain A residue 32 type catalytic sequence D description 723 source MCSA : MCSA1 19) chain A residue 64 type catalytic sequence H description 723 source MCSA : MCSA1 20) chain A residue 155 type catalytic sequence N description 723 source MCSA : MCSA1 21) chain A residue 221 type catalytic sequence X description 723 source MCSA : MCSA1 22) chain A residue 28-39 type prosite sequence VAVIDSGIDSSH description SUBTILASE_ASP Serine proteases, subtilase family, aspartic acid active site. VAVIDSGIdssH source prosite : PS00136 23) chain A residue 64-74 type prosite sequence HGTHVAGTVAA description SUBTILASE_HIS Serine proteases, subtilase family, histidine active site. HGThVAGtVAA source prosite : PS00137 24) chain A residue 32 type ACT_SITE sequence D description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01240, ECO:0000269|PubMed:5249818 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 64 type ACT_SITE sequence H description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01240, ECO:0000269|PubMed:5249818 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 221 type ACT_SITE sequence X description Charge relay system => ECO:0000255|PROSITE-ProRule:PRU01240, ECO:0000269|PubMed:5249818 source Swiss-Prot : SWS_FT_FI1 27) chain A residue 2 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI2 28) chain A residue 41 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 29) chain A residue 75 type BINDING sequence L description source Swiss-Prot : SWS_FT_FI2 30) chain A residue 77 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 31) chain A residue 79 type BINDING sequence I description source Swiss-Prot : SWS_FT_FI2 32) chain A residue 81 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 33) chain A residue 169 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI2 34) chain A residue 171 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 35) chain A residue 174 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links