eF-site ID 1sth-A PDB Code 1sth Chain A click to enlarge Title TWO DISTINCTLY DIFFERENT METAL BINDING MODES ARE SEEN IN X-RAY CRYSTAL STRUCTURES OF STAPHYLOCOCCAL NUCLEASE-COBALT(II)-NUCLEOTIDE COMPLEXES Classification HYDROLASE (PHOSPHORIC DIESTER) Compound STAPHYLOCOCCAL NUCLEASE Source Staphylococcus aureus (NUC_STAAU) Sequence A:  KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETK HPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKY GRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHL RKSEAQAKKEKLNIWS Description Functional site 1) chain A residue 21 type sequence D description BINDING SITE FOR RESIDUE CO A 150 source : AC1 2) chain A residue 40 type sequence D description BINDING SITE FOR RESIDUE CO A 150 source : AC1 3) chain A residue 41 type sequence T description BINDING SITE FOR RESIDUE CO A 150 source : AC1 4) chain A residue 35 type sequence R description BINDING SITE FOR RESIDUE THP A 151 source : AC2 5) chain A residue 40 type sequence D description BINDING SITE FOR RESIDUE THP A 151 source : AC2 6) chain A residue 71 type sequence K description BINDING SITE FOR RESIDUE THP A 151 source : AC2 7) chain A residue 83 type sequence D description BINDING SITE FOR RESIDUE THP A 151 source : AC2 8) chain A residue 84 type sequence K description BINDING SITE FOR RESIDUE THP A 151 source : AC2 9) chain A residue 85 type sequence Y description BINDING SITE FOR RESIDUE THP A 151 source : AC2 10) chain A residue 87 type sequence R description BINDING SITE FOR RESIDUE THP A 151 source : AC2 11) chain A residue 89 type sequence L description BINDING SITE FOR RESIDUE THP A 151 source : AC2 12) chain A residue 113 type sequence Y description BINDING SITE FOR RESIDUE THP A 151 source : AC2 13) chain A residue 115 type sequence Y description BINDING SITE FOR RESIDUE THP A 151 source : AC2 14) chain A residue 21 type catalytic sequence D description 165 source MCSA : MCSA1 15) chain A residue 35 type catalytic sequence R description 165 source MCSA : MCSA1 16) chain A residue 40 type catalytic sequence D description 165 source MCSA : MCSA1 17) chain A residue 41 type catalytic sequence T description 165 source MCSA : MCSA1 18) chain A residue 43 type catalytic sequence E description 165 source MCSA : MCSA1 19) chain A residue 87 type catalytic sequence R description 165 source MCSA : MCSA1 20) chain A residue 21 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 21) chain A residue 40 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI2 22) chain A residue 41 type BINDING sequence T description source Swiss-Prot : SWS_FT_FI2 23) chain A residue 35 type ACT_SITE sequence R description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 43 type ACT_SITE sequence E description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 87 type ACT_SITE sequence R description ACT_SITE => ECO:0000269|PubMed:288045 source Swiss-Prot : SWS_FT_FI1 26) chain A residue 19-43 type prosite sequence DGDTVKLMYKGQPMTFRLLLVDTPE description TNASE_1 Thermonuclease family signature 1. DGDTVkLmykgqpmtf.RLllVDtPE source prosite : PS01123 27) chain A residue 83-93 type prosite sequence DKYGRGLAYIY description TNASE_2 Thermonuclease family signature 2. DKYGRgLAyIY source prosite : PS01284

Display surface Download Links